CAZyme Information: MGYG000001210_00067

Basic Information

• Species: Mediterraneibacter sp900553885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900553885
• CAZyme ID: MGYG000001210_00067
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1364		150647	4.0703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001210	2584596	MAG	Austria	Europe

• Gene Location: Start: 9824; End: 13918 Strand: -

Full Sequence      

MKKKKLSFIAALSVFSMTVTSVLPAMAAPTANDAGKAGDALENQVLDLEFEGDLKDGTDT
IADISISGDGYEYVDGVNGGKALSLTGNTYVNLGKDQRLQPENLTLSFWINPNETITGEQ
IISWNKQEYYTDGWYLTSENDNTPLALSIGEGANGGQPYKVSVKGNRAEFFPAGEWTHIV
VTYDSETKDVAFYRNGVAQSVNVDYAVGEGRDGLLGSDPDMEKSIGYNGPAYKGAYMNAA
LDHYELFNDTATAEQALALYEENKETETSGLKNQVLDLEFEDNLTDGTGINTDIKFSGSG
YEYVDGANGGKALKLTGNTYIDLGRNTELQPKNLTLSFWINPEKTMTGEGIISWNKNEYY
TDGWYLSSEGDNVPLALSIGEGKNAGQPYKVSIKGNRAEFFPAGEWTHIVVTYNSASKEV
VFYRNGIEQTSTIDYAVNSDRDGVLGSDASMQKSIGYNGPAYNGSYLKAALDHYELFNDT
ATKEEAMALYEENGGEIDKAQIAKDDLDALNIPAETSRNLALPSVGEQGSVITWEVTAGT
AMDNNGVITRPEIGEPDAKVTLTATAVFMDGEAATKTFDVTVLAKKPMDLSDTSLMDDVT
LADDYMVNAFTKEEEYLLSLNSEKFLYEFYNVAGLEPTTEEGYGGWERTGASNFRGHTFG
HYMSALSQAYLSEDDADVKAQLMEQIEDAVNGLKKCQDAYAAMYPQSAGYISAFPEGVLA
RVDGGTSPTPDDGTVLVPYYNLHKVVAGLIDVAKNVDDTEIKNTAIEVAEAFGEYLYNRC
TNLPNKQQLLWIEYGGMNEALYELYRITGNDHIKAAAECFDEVSLFQQLAAGQDVLSGKH
ANTTIPKFTGAVKRYSVLTENKEYYDRLTQEEKDNLDMYLTAAENFWDIVVNDHTYITGG
NSQSEHFHNAGELCYDATKGSYDGALTCETCNTYNMLKLTKALYDQTQDPKYLDFFERTF
TNAILASQNPETGTTMYFQPMAAGYNKVYNRPYDEFWCCTGTGMENFSKLGDYIYQIKGN
TLYVNMFYSSTVEDGGLGISLTQDANIPNEDTVIYTVNDIADGTSVALRQPEWLAGDAVI
KVNGEVKDVTAENGFFVLEGLKAGDEISYTMPMQVEIESTADNENFVAFKYGPVVLAAEL
GSKDIDASQANGILVRVGTEDTSAKDTITVQNMSVEEWKSNITENFVRIEDSEDGRVQFQ
LKNTDSEELIYSPYYMQHEQRYGIYMNLEEPDSQASQDRILAEKETLREQEVSVDYLDSF
DNNNSEFAKNLQTGGDTSTGTFNGRTFRHANAGGWWSYDLAVDPEADHNYLGCTWYSGDQ
GRSFEIYVNDSLLKTVQINNAAGTNVFYEDLYDITDYIKVGLRK

Enzyme Prediction     

No EC number prediction in MGYG000001210_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	598	1137	6.3e-168	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.52e-125	598	1137	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.11e-82	599	1141	12	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam13385	Laminin_G_3	6.12e-15	85	255	1	149	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam13385	Laminin_G_3	7.84e-13	315	485	1	149	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
cd00152	PTX	7.73e-06	80	220	6	139	Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity. CRP binds to ligands containing phosphocholine, SAP binds to amyloid fibrils, DNA, chromatin, fibronectin, C4-binding proteins and glycosaminoglycans. "Long" pentraxins have N-terminal extensions to the common pentraxin domain; one group, the neuronal pentraxins, may be involved in synapse formation and remodeling, and they may also be able to form heteromultimers.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDP74899.1	0.0	275	1361	47	1144
QUB98427.1	0.0	275	1361	47	1144
QJW37681.1	0.0	271	1361	43	1144
ARK06383.1	0.0	275	1361	47	1144
ARU52215.1	0.0	275	1361	47	1144

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.91e-81	596	1361	30	778	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.23e-78	596	1361	30	778	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.30e-16	739	1139	142	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5HO0_A	8.40e-07	413	603	470	657	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]
5HO9_A	1.29e-06	413	583	470	637	Structureof truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus],5HO9_B Structure of truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.998845	0.000217	0.000232	0.000202	0.000183

TMHMM  Annotations     

start	end
7	29