CAZyme Information: MGYG000000323_00067

Basic Information

• Species: Enterococcus_D sp002850555
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D sp002850555
• CAZyme ID: MGYG000000323_00067
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000000323_1|CGC1	41374.55	4.6279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000323	3361404	MAG	Sweden	Europe

• Gene Location: Start: 69157; End: 70248 Strand: +

Full Sequence      

MGKLGISIYPERSTFEKDKAYLDLAHKYGFKRVFTSLLQINDDKEKVLADFKQVVDYANQ
LGMEVMVDINPGLFEQLGISYDDLSFFDEMGAYGVRLDIGFTGSEEAKMTRNPYGIKIEI
NMSSGTSYVDNIMSYSPNTENLLGSHNFYPHRYSGLGYDHFVFCSEKFRKYNLNTMAFVN
SHEADFGPWPTQDGLCSLEDHRDLPLATQVKHLVLTGLIDDISIGNAYASEAELAAMAEA
FHADYPTLRVDVVDGITEDERICLFDNLHSYRGDRSEYILRSTMTRIYYKDKEFPPHDTH
DMVRGDVLIDNAGYGQYKGETQIALKEMKNDGRVNVVGKIAEEELFLLEFLKPWSSFKLV
ENN

Enzyme Prediction     

No EC number prediction in MGYG000000323_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	3	360	6.4e-127	0.9971428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3589	COG3589	5.96e-155	1	362	1	359	Uncharacterized protein [Function unknown].
pfam19200	DUF871_N	1.72e-126	4	228	1	224	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
pfam05913	DUF871	2.25e-42	246	360	1	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
cd00551	AmyAc_family	0.008	25	98	53	117	Alpha amylase catalytic domain family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; and C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost this catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF73443.1	2.19e-272	1	363	1	363
AYJ45737.1	8.54e-270	1	363	1	363
AUJ85501.1	1.21e-269	1	363	1	363
EEV38783.1	4.94e-269	1	363	1	363
QOG31042.1	1.42e-268	1	363	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	1.04e-134	3	361	28	385	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]
2P0O_A	9.14e-24	5	360	6	358	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000323_00067.