CAZyme Information: MGYG000000495_00382

Basic Information

• Species: HGM11501 sp900766735
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; HGM11501; HGM11501; HGM11501 sp900766735
• CAZyme ID: MGYG000000495_00382
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		60871.31	4.3645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000495	2149207	MAG	Fiji	Oceania

• Gene Location: Start: 103571; End: 105202 Strand: -

Full Sequence      

MKLKTLINTIIVASVLTVSTVVSAADYADVPDEHWATAVINEAAEAGIMYGRDDGTFGLG
DTVKRSEFAAMLVRLMKWDKSVSAISLFSDVQSDKWYFADINTLADHNVFNEKEFRPNDN
ITRREMAVMLVKALGYSELAQSETSSVFNDVSTDEGYISVAYTLGIINGKSDTMFDPEGP
ALREEGAAMMMRMYNKYYSSLNEIHGFYAISSWGQKEMAAQMDSVSFGWSRLQYTDDNVV
LLNQTSDGGNDWCVPDGSQNAIDYMRENGVSINLAVTMTDTEDCNVILLNSENRSEAIRQ
ILSASDNFDGITIDFEGMKGTELKEGLNEFVKELKTMLGNKMLYIAVHPVLKHSNEYFDA
YDYKTLGDYADRIILMAHDYAAYTLPDNLINTNFIATPVTPFDEVFTALKAITNPITGVS
DKSKIQLAISTASTTAWNTTDKRITDNTAIHPSIDTVQKRLAQNDTEITYSQVYKNPYAF
YNTESNQQILLWYEDSRSVKDKINLAKMFGIKSVSIWRIGTVANGNSEQYMDIWNTIISE
YQN

Enzyme Prediction     

No EC number prediction in MGYG000000495_00382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	206	526	3.5e-28	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.78e-35	254	520	43	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
pfam00704	Glyco_hydro_18	9.65e-17	287	520	82	305	Glycosyl hydrolases family 18.
NF033190	inl_like_NEAT_1	2.90e-15	22	196	577	754	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
COG3858	YaaH	1.13e-13	287	520	184	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	1.92e-12	290	521	88	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX64072.1	4.73e-137	5	528	8	553
ANW99040.1	2.34e-129	29	539	34	574
ANX01568.1	2.34e-129	29	539	34	574
AGC68707.1	2.34e-129	29	539	34	574
AGI39716.1	2.34e-129	29	539	34	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	2.56e-10	285	520	187	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4AQ1_A	5.57e-07	40	195	15	169	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]
4AQ1_C	5.57e-07	40	195	15	169	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]
4Q6T_A	5.19e-06	302	520	108	325	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	1.49e-14	33	196	1687	1857	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	2.06e-13	33	196	913	1083	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P19424	2.36e-12	27	199	41	219	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
C6CRV0	1.89e-11	26	194	1285	1459	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P0DPJ9	3.38e-10	285	520	186	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.998953	0.000191	0.000203	0.000188	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000495_00382.