CAZyme Information: MGYG000001159_00252

Basic Information

• Species: Bifidobacterium pullorum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium pullorum
• CAZyme ID: MGYG000001159_00252
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
992	MGYG000001159_12|CGC1	108065.09	3.979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001159	2232439	MAG	Austria	Europe

• Gene Location: Start: 123613; End: 126591 Strand: -

Full Sequence      

MGASHVFPQGGTTVKRRIAAIAAGIATAAMALGGVVAPPATAYADEPAAADVSSVTNPNN
RHFMVYYRAWRDVTMKGVNTDLPDENWISMYDIPYGVDVVNVFSYVPAGQEAAAQPFYDK
LKAEYAPYLHSRGIKLVRGINYEQVTVEGFRDYMADLGKTADEATEADYDAYALEIIDEY
MTSVGLDGLDIDMETYPTDADVAISDNVIRALSKHIGPKSDDPDGTMFLYDTNGSNTKPF
ANVADCFDYVAYQQYGSTSTRTAGAVADYSPYIGADKFVPGLAFPEEGDHNRWYDATEPY
TDSHIYDIASYVRDNGLGGMFLYALDRDGRTYEAEDWSHIVPSNLLWTKTAIAESQDMTM
EQAKAAANHYIERMSLTEEGAAGVALNAEDALEAVEQATNLYEVNKAVLGGDYDEGFSNT
YDPTLEVGLLGVDTTELMDRISAADNILAGDVMSDDVKSAVRQSRDAAVEGLTGRTYTAD
EVAMWTADLQADIEAAMASLTGVESSDRHFMVYYRAWRDVTMKGVNTDLPDENWISMYDI
PYGVDVVNVFSYVPAGQEAAAQPYYDKLKSDYAPYLHSRGIKLVRGVDYTGVIVDGFRDF
IEAKGLTEQEATEADYDEYALQVIDEYMTSVGLDGLDIDMETHPDEADVAVSDNVIRALS
KHIGPKSDNPDGTMFLYDTNASDLAPFRNVADCFDYVAYQQYGSNAERTDDAFGDYAPHI
GSEFVPGLTFPEEGDMNNRWYDATEPYEESNFYQVASYVNEHKLGGMFVYALDRDGRDYE
DDLTRIVPSNLLWTKTAIAESQGMPLDQAKAAAKHYIERMSLASAEGVALNADEAGAAVA
AAANLYEVNKAVLGGDYGEGFSNTYDPTLEAGLLDIDIDELMSLIEQADKALEAEDDDTV
RTARDAAMDGLTGKIYTADEVGQWVDALTAALKGEETPSGPDDTSKPNTDVQKPADEKPL
ASSGSAVAAVLSVAVAAAVAGIGLTVWRRRKV

Enzyme Prediction     

EC	3.2.1.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	1.60e-45	62	336	2	249	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
cd06542	GH18_EndoS-like	6.31e-44	509	781	2	247	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAJ70116.1	2.50e-228	491	989	34	543
QKY14302.1	2.50e-228	491	989	34	543
VEG44861.1	2.50e-228	491	989	34	543
ACJ53522.1	2.50e-228	491	989	34	543
QTB92326.1	7.07e-228	491	989	34	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7PUJ_A	1.54e-151	505	932	8	429	ChainA, Beta-N-acetylhexosaminidase [Enterococcus faecalis],7PUK_A Chain A, Beta-N-acetylhexosaminidase [Enterococcus faecalis],7PUK_C Chain C, Beta-N-acetylhexosaminidase [Enterococcus faecalis]
6KPL_A	1.89e-31	495	798	16	292	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	2.16e-30	495	798	16	292	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]
6E58_A	5.03e-18	66	345	28	319	Crystalstructure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) [Streptococcus pyogenes M49 591],6E58_B Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) [Streptococcus pyogenes M49 591],6MDS_A Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with complex biantennary glycan [Streptococcus pyogenes],6MDS_B Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with complex biantennary glycan [Streptococcus pyogenes],6MDV_A Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with high-mannose glycan [Streptococcus pyogenes],6MDV_B Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with high-mannose glycan [Streptococcus pyogenes]
4NUY_A	1.21e-12	66	338	20	320	Crystalstructure of EndoS, an endo-beta-N-acetyl-glucosaminidase from Streptococcus pyogenes [Streptococcus pyogenes serotype M1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7GPC7	5.00e-229	491	989	34	543	Endo-beta-N-acetylglucosaminidase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) OX=391904 GN=Blon_2468 PE=1 SV=1
P36912	3.16e-29	497	775	49	307	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004387	0.978949	0.000457	0.015394	0.000497	0.000295

TMHMM  Annotations     

start	end
21	43
965	987