CAZyme Information: MGYG000004236_00079

Basic Information

• Species: UMGS1071 sp900542375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1071; UMGS1071 sp900542375
• CAZyme ID: MGYG000004236_00079
• CAZy Family: GH18
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	MGYG000004236_1|CGC2	72928.64	4.2092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004236	2130526	MAG	United Kingdom	Europe

• Gene Location: Start: 70235; End: 72205 Strand: -

Full Sequence      

MPNIKLVPRQDGEYDILIEYSKADVEFAWEFGKRKNKHTNSEGILKSISEYAKKAKIKSV
KIFASGILVASLSLTSFLSVFAASDRYIMGYLYSGTDHQQIEYVNQTGQTLDTVSPSYFN
IQEDGSLTLNYVSTYLIDSMHAKGIKVVPFLSNHWDRTAGINALKDVETLSTQIADDIEK
YNLDGVNVDIENVTHEQRDQYTQLVKLLREKIPSHKEVSVAVAANPNDWQTGWHGSYDYS
ALAQYADHLFIMTYDEHYEGGAAGPVAGIQFVEDSIQYALSKTTADKIVIGVPLYGRVWS
LDDNRIVGKGISSKTIQDILNNCESTVTYDETSQSVKAEFTITEQSTRYTVGGDFVLQPG
KYVVWYENDQSYETKLGLVEKYNLKGAGSWALGQEDPSIWDHYEEWINGETQDTTPSEPS
IPNQPEQPDTSEPVIPQPPNPPSPSEPEPPESIVPPETNLPESSPSEPEESEPPISSDTP
ESSEPPTTEQPDSSNPTEPESPERPVTPEPESPESPVPSEPQQPDSSIPSIPQTPTPPNT
ESPSETPPTSPESNHLIHQVISGDTLWGIAEKYLGSGFRYHEIMQLNGLTSTLIYPGDQI
KLPIQYQEYTVQKGDSLWKIAQEQLGSGTRYTEIMQLNHLSSDVIYPGQIFKLPIV

Enzyme Prediction     

No EC number prediction in MGYG000004236_00079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	104	395	4.1e-43	0.8581081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.97e-75	88	403	4	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.00e-72	82	401	98	416	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	2.46e-31	165	394	87	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	6.32e-30	168	394	93	333	Glyco_18 domain.
cd06549	GH18_trifunctional	3.69e-25	173	400	95	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61558.1	3.18e-129	1	407	1	404
QHS23529.1	1.27e-108	12	406	16	415
AFS78333.1	1.00e-107	82	410	32	360
AOT69058.1	3.83e-106	66	409	14	356
QDP41482.1	2.53e-104	5	408	7	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	4.09e-22	185	392	114	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3K_A	4.22e-21	104	400	128	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	1.79e-19	172	400	201	418	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4WIW_A	5.95e-19	111	396	34	333	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4Q6T_A	1.98e-18	185	400	116	332	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31682	3.59e-64	89	299	4	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O32258	5.20e-28	179	400	128	336	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P37531	2.07e-22	170	400	196	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	6.20e-21	185	392	206	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	1.26e-19	172	400	200	417	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999709	0.000281	0.000015	0.000001	0.000000	0.000010

TMHMM  Annotations     

start	end
62	84