CAZyme Information: MGYG000004285_00631

Basic Information

• Species: UMGS1670 sp900546215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; UMGS1670; UMGS1670 sp900546215
• CAZyme ID: MGYG000004285_00631
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	MGYG000004285_5|CGC2	60397.4	4.2624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004285	2345577	MAG	China	Asia

• Gene Location: Start: 77363; End: 79003 Strand: -

Full Sequence      

MIRKKIALALAAAASTIMCVTAFASPYSDVPENHWAYSEIQKAGEIGFMNGMGDGTFGLG
QNVTRAQFVSMLVRMFGWQQAQGASYTDVDPSAWYYNDIITASANGALDSGSTFRPNDNI
TREEIAVMLVRALGYDELGKEFSNTILPFSDVTSNKGYISLAYDFGIVSGKSANTFDPDG
TALREEAAAMMMRCYNKYNSFVDFLHGFYAFSSYSQKDMAGQMDAVSFGWGRMEYSDEKG
VVVNTTSDNNNEWNVPSGYTDIVEYLRANNVDTNLSIYMSASEGDDAEIILGSAENRTAA
VNAIVEELTVDYRQLGYNPYGGVTIDFENLRGREMRDNFTAFISELKGELSSIGKRLYVT
VQPNMINSTYFDGYDFASIGNLADKVILMAYDYNAKSISQEVMDSGFTTTPVTPFDEVYY
ALKTITAQVSDRSKVVLGLSMSNVGWTVSDGQITNSRGNTYSYAEIADMINSGAEVKYSD
KYKNPYLIYNNGDEKEIVWYENEQSVKDKIKLAEMFGISGVSVWRLGIIPQNGSDLNIWS
GIANLR

Enzyme Prediction     

No EC number prediction in MGYG000004285_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	206	527	4.7e-35	0.8141891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.41e-33	255	532	43	309	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	6.13e-26	273	532	168	414	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	1.78e-22	243	524	34	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	2.12e-21	290	524	82	302	Glycosyl hydrolases family 18.
cd06549	GH18_trifunctional	2.55e-18	209	539	12	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX64072.1	4.74e-160	20	542	23	559
QHI71217.1	6.07e-158	27	531	34	543
QAT42616.1	1.22e-157	27	531	34	543
QIB69198.1	2.03e-153	27	531	34	543
ANW99040.1	2.85e-137	27	544	32	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WIW_A	9.81e-14	307	535	121	338	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
5XEP_A	1.61e-10	252	534	71	363	Crystalstructure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_B Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_C Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_D Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_E Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_F Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus]
4Q6T_A	1.82e-09	320	527	114	325	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
5WUS_A	2.17e-06	320	534	112	347	Crystalstructure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38535	1.40e-15	27	200	908	1086	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38536	6.58e-15	27	191	1682	1851	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
C6CRV0	4.34e-14	15	193	1272	1457	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P19424	1.97e-13	24	243	38	257	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
O32258	3.01e-11	275	527	91	329	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000381	0.998413	0.000574	0.000248	0.000207	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004285_00631.