CAZyme Information: MGYG000000325_00060

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95
• CAZyme ID: MGYG000000325_00060
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	MGYG000000325_1|CGC1	64828.31	5.7353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000325	3194566	MAG	Sweden	Europe

• Gene Location: Start: 61663; End: 63342 Strand: +

Full Sequence      

MIRTFNTHSIRKQRELTGRYWNFTPCQGDYAGESFKVATPSCFESYPKFANYRGQGEYST
TFEAQGNIRLEFKGVSHTAEVFLDGRKIAEHYNAYTIFDAVCTDLKPGVHTLMVRADNRF
SEKSALHIPNDYMTYGGIIRPIVLEEVRAAYIQYVHVTPYRANGKWNARVTVKLKNVFSK
DSVSKEEKRFDLALELAGLNVMLSDIDITTQQEITTECVFENVEAWTPEHPQLYEVQVRL
LQKGMVYDDLIDRFGFREIHVSGKEIYLNDKKIRIKGLCRHEDHPQFGCALPFAAMAADL
ELIKDLGANSIRTSHYPNDEIFLDMCDENGILVWEENHARGLSEEAMRNSNFEWQAEQVI
TEMIPAHYNHPSIYIWGILNECASETEYGRECYRRQFDLIRSLDTSRPCSFASCKIKTDI
CLDLPDVVSYNIYPLWYHDTPVEEYLDDLYQWIQRDTKGSGKPFLVTEIGAGGLYGYRNA
YHSKWTEEYQAQALEKQLTAVLSYKDCMGVYIWQFCDIRISDECFAGRPRTMNNKGIVDE
YRRAKLAYDVVKRIYHEIN

Enzyme Prediction     

No EC number prediction in MGYG000000325_00060.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	11	558	9.3e-92	0.6143617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	3.31e-73	51	559	62	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	6.45e-56	11	548	10	588	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	8.16e-41	259	559	1	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.16e-36	56	517	111	547	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	4.20e-21	56	408	122	484	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44889.1	1.18e-289	1	559	1	555
AYJ45883.1	3.17e-272	1	555	1	551
SET92908.1	8.54e-255	1	555	1	549
QOV20934.1	4.55e-243	1	556	1	554
QBE97736.1	8.01e-243	1	555	1	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NCW_A	5.87e-246	1	558	1	555	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
7VQM_A	1.69e-49	52	558	92	587	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
6ED1_A	3.81e-48	68	548	96	592	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6XXW_A	3.45e-47	11	558	30	592	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6D89_A	3.06e-46	52	558	103	590	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	3.94e-47	52	552	100	625	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P05804	1.25e-41	33	559	41	592	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	2.91e-36	29	431	26	431	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	6.32e-36	68	552	73	542	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
O77695	2.14e-34	131	558	204	626	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999370	0.000657	0.000005	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000325_00060.