CAZyme Information: MGYG000001427_00657

Basic Information

• Species: Enorma timonensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Enorma; Enorma timonensis
• CAZyme ID: MGYG000001427_00657
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000001427_58|CGC1	72633.12	6.2684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001427	2331554	Isolate	not provided	Europe

• Gene Location: Start: 43264; End: 45240 Strand: +

Full Sequence      

MLDVRRALKAAQVPARTRTLPLSTPWGEAIASAGDDAPVLPEHPRPTTRRDAYTMLNGMW
EYAFTPLPVELPPRNTRTGDARPLALNRDEALAVVSSALAPITFNSGRIRVPFSPEAPLS
GVNRMLRPDELLWYRRTFEPPALTAGERLILHFEAVDWVCAVYVNGQLAGEHAGGYLPFD
IDATPYLRPASTEPTELMLCVYDPSDAGVQPRGKQSLAPGGIWYTAQSGIWQSVWYEVVP
AMHLTSLSLSGAADGTLAIDARAAGAEASGRALELTVLDHAGATVLQQTLPLDARGRLRA
TLAVENPHRWSPDDPYLYQVKARLCEGSPTTAASAPDSVESYCAFRTVSIERDAQGVPRF
FLNGEPYFVKGVLDQGYWPDGLMTAPSDEALIHDISAMKAAGFTMMRKHLKIECARWYYH
CDRLGMLVWQDAVQGGGPYSLWHISRKPTVFKRTWGRFRDDIPPHRAALASTDVRYQLEW
NETCAAMVRLLACHPSIATWSLFNEGMGQFDARAAAEHIHGIDATRPIDAVSGWFDQHCG
DYLSQHNYFRPLTADRDRGRLSGYVAQRGFRALFLSEFGGWGQPVEGHRFSDAAYGYGEF
DGIDAWRAAVRASLATAGDLEARGLAGYVYTQLSDVEDEVNGLITYNRRVCKITPGVF

Enzyme Prediction     

No EC number prediction in MGYG000001427_00657.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	46	541	2.8e-97	0.4946808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.98e-42	133	528	66	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.98e-26	133	505	68	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.03e-20	109	526	99	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.96e-17	134	505	124	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	4.65e-17	56	234	4	163	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB06425.1	1.01e-270	1	653	19	666
AII76886.1	4.69e-253	1	652	1	712
AZH72092.1	9.42e-253	1	652	1	712
AXR42361.1	9.42e-253	1	652	1	712
VEG24656.1	1.71e-252	1	654	1	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.24e-114	22	653	12	570	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5UJ6_A	1.66e-24	133	505	79	418	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	1.67e-24	133	505	87	426	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	5.13e-24	133	505	87	426	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
3FN9_A	5.63e-21	133	597	63	520	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	2.88e-22	133	531	59	415	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	3.47e-19	133	505	106	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q02603	2.95e-17	134	544	132	505	Beta-galactosidase large subunit OS=Leuconostoc lactis OX=1246 GN=lacL PE=1 SV=1
A7MN76	4.54e-17	51	543	60	509	Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=lacZ PE=3 SV=1
Q56307	6.10e-17	51	528	37	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001427_00657.