CAZyme Information: MGYG000001476_00679

Basic Information

• Species: Caproiciproducens sp000752215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp000752215
• CAZyme ID: MGYG000001476_00679
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	MGYG000001476_8|CGC3	67009.61	5.0201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001476	3737722	Isolate	not provided	not provided

• Gene Location: Start: 192582; End: 194327 Strand: +

Full Sequence      

MRNEYPRADFVRKDWLSLNGEWDFSFEYGPACKIQVPFVYQCKKSGINDQKTCRTVTYKR
KFTVPPGWRGKDIVLHFGAADYRCKVCVNGRYVGGHVGGHTPFELDITDDVNWKEEEILV
IVEDFPTDETIARGKQFWREKPEYIWYTGSTGIWQSVWIEPRTKACFEWIHFTPDIDNGQ
VKISYRLGDGTPLPCSSKWEITLQGEIFFSGELLCREYEDSFTVTVFGNHVLSGPFHSDG
LCWSPDSPTLFDVTAQLLEDGKAADTVNSYFGMRKISVENGMLYLNNHPCYQKLLLDQGY
WEESLLTAPDDEAFQQDILRAKAMGFNGCRKHEKLEDPRFLYWADKLGFLVWEGMASFIS
YTPSAAAQFIKEWEEVIHRDYNHPSIIVWGMLNESWGVPQIYDNLMQQHYAASLYHLAHS
LDSTRLVISNDGWEMTETDVCAIHSYSHGTEDDRRQQLVFAECVKTWPGIESGKIVSHLP
FAKGYHYQGQPVILTEFGGISGAEGEEGWGYTCAHSEKEFLEVYRRLITVLNDSEILCGF
CYTQLADVQQETNGLLNKMHEFKYDPKKIREINQLIERRMV

Enzyme Prediction     

No EC number prediction in MGYG000001476_00679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	11	469	1.2e-95	0.5159574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.47e-32	17	395	14	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	7.26e-30	16	427	13	445	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.00e-23	34	427	99	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.16e-12	276	505	1	218	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	5.65e-12	17	157	3	163	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL05530.1	1.61e-251	1	573	1	585
QRV20309.1	1.61e-251	1	573	1	585
QQK07792.1	2.73e-240	1	573	1	571
AGA57247.1	5.76e-213	2	575	4	591
AMQ06231.1	4.02e-208	1	574	1	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	7.46e-78	4	576	28	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5UJ6_A	1.10e-26	3	547	22	569	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	2.60e-26	11	547	38	577	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	2.45e-24	11	547	38	577	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6XXW_A	7.99e-24	5	547	23	554	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	2.71e-24	14	425	11	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	6.61e-22	58	501	107	520	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q03WL0	2.15e-19	4	497	66	533	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
P26257	1.16e-18	16	425	5	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
A0KQH4	2.01e-18	7	395	38	463	Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001476_00679.