CAZyme Information: MGYG000001816_01402

Basic Information

• Species: CACZQA01 sp902783175
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; CACZQA01; CACZQA01 sp902783175
• CAZyme ID: MGYG000001816_01402
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		59488.22	4.0034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001816	1900331	MAG	Denmark	Europe

• Gene Location: Start: 133; End: 1725 Strand: +

Full Sequence      

MNETGGKIAAHVIDAAGRSVAFQSVNVTPDRLDTVELRLHVPSPHPWTPDDPYLYSIELS
YDADDVNSYCAFRTTTIEPDEKGVQRFCLNHEPLFLRGVLDQGYWPDGLMTAPSDEALRF
DIEAMASLGFNMIRKHIKVESERWYYLCDRMGMLVWQDMVSGGEDPHVWIASRIPTTFKW
FWSHYRDDTEKHQRHLSSDNALYRNEWQALAGSTVRRLKSHPCIITWSLFNEGWGQFDAA
KATESVKSIDTTRPVDSTSGWFDQGCSDYNSVHNYFRDNEMFDDPFSLGRPLVVTEFGGL
SFHIPEHSSWNTSFGYASFDAVEQWRKAVWGLLDQMDSLERKGLSGYVYTQLCDVEQETN
GILTYDRRVNKLETVRLEDLHTDDEADEARAVEEEDDDGVSDGETSESTEQAPIEELELG
RADEKSDGSPAQTEDDPAENGAVSLETSVEDTTDVNNSTDELESSTSDQDQDADDKPSDD
DEPKADGAETSEDTEQAVESDACEDSEAAGDQEALPSNEEADSSGNKARS

Enzyme Prediction     

No EC number prediction in MGYG000001816_01402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	28	404	1.5e-61	0.42819148936170215

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.57e-27	2	255	210	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.63e-14	3	255	207	445	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	5.15e-13	87	367	8	284	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	1.65e-12	33	255	288	485	beta-galactosidase.
PRK10340	ebgA	1.21e-09	17	255	255	472	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS69434.1	1.29e-147	37	372	280	615
BAK45232.1	7.50e-147	37	373	274	610
ACV55172.1	2.73e-146	5	379	246	617
ACV23240.1	1.50e-138	39	372	266	599
VEH02373.1	1.50e-138	39	372	266	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.51e-69	2	382	221	580	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6NCW_A	3.46e-11	47	355	223	515	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
3GM8_A	3.91e-10	47	275	238	442	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
3IAQ_A	4.28e-10	33	335	287	573	ChainA, Beta-galactosidase [Escherichia coli K-12],3IAQ_B Chain B, Beta-galactosidase [Escherichia coli K-12],3IAQ_C Chain C, Beta-galactosidase [Escherichia coli K-12],3IAQ_D Chain D, Beta-galactosidase [Escherichia coli K-12]
3I3B_A	7.44e-10	33	335	287	573	ChainA, Beta-galactosidase [Escherichia coli K-12],3I3B_B Chain B, Beta-galactosidase [Escherichia coli K-12],3I3B_C Chain C, Beta-galactosidase [Escherichia coli K-12],3I3B_D Chain D, Beta-galactosidase [Escherichia coli K-12],3I3D_A Chain A, Beta-galactosidase [Escherichia coli K-12],3I3D_B Chain B, Beta-galactosidase [Escherichia coli K-12],3I3D_C Chain C, Beta-galactosidase [Escherichia coli K-12],3I3D_D Chain D, Beta-galactosidase [Escherichia coli K-12],3I3E_A Chain A, Beta-galactosidase [Escherichia coli K-12],3I3E_B Chain B, Beta-galactosidase [Escherichia coli K-12],3I3E_C Chain C, Beta-galactosidase [Escherichia coli K-12],3I3E_D Chain D, Beta-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1SWB8	7.64e-13	33	280	286	507	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
A5F5U6	2.13e-11	7	268	251	495	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
Q6D736	4.91e-11	33	335	298	584	Beta-galactosidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lacZ PE=3 SV=1
Q7MG04	3.40e-10	33	370	283	610	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q6LL68	3.40e-10	33	297	282	533	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000008	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001816_01402.