CAZyme Information: MGYG000003179_00282

Basic Information

• Species: UMGS1004 sp900547645
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS1004; UMGS1004 sp900547645
• CAZyme ID: MGYG000003179_00282
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000003179_5|CGC1	68633.23	5.1785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003179	1597931	MAG	United States	North America

• Gene Location: Start: 127; End: 1902 Strand: +

Full Sequence      

MQHTQCYIKDYPRPQFVRKEWHNLNGDWDFAFDDKNCGEREEWFCSGFPTGMKIRVPYSY
QTSASGVERAERHDNIWYRKEVLRPACSADSRLILWFEGSDYITKVWVNGIYIGKHEGGY
CRFCFDITDAALKSTETYTLTVKCEDTYDAAQPRGKQKWMEKPYGCWYVETNGIWKTVWT
EVVSADRIGRMKFTPNKATYCVDFDAEITGDCRGLELVTQVSREGRLVAENTLVVVRDRF
SYSIDLSDDQAQFKIEWWSMAHPALYDLKFVLKRDGKVIDEVGSYFGFRAFYAQKDTLVL
NNGPTYLKMVLEQGYCRNSGMTYPDEESIVHELELIKKLGFNGVRMHQKIEDERFFYYAD
ILGIATWVEMPSAYEYRDATVDKATAEWQEIVHQHYNHPSVLAWVPINESWGVPRILNNC
REQHFTQALYHLTKSYDPMRPVISNDGWEHTESDIITLHNYEQCPEIFGEFYRDLDKTLS
GENISDYVQWRLPFAEGHGYRGQPVMITEFAGIGFDTEQTDGGWGYGSQVRTKEQFAERL
SALVRAVRENKRICGFCVTQITDVEAEINGLCNADRTPKADMDVLAKAIRQ

Enzyme Prediction     

No EC number prediction in MGYG000003179_00282.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	16	588	3.1e-85	0.613031914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.87e-35	14	512	6	487	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	7.43e-31	23	517	14	513	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	7.07e-17	24	128	4	119	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02836	Glyco_hydro_2_C	1.13e-10	325	589	34	297	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam00703	Glyco_hydro_2	6.10e-08	187	289	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY70926.1	6.06e-209	5	583	4	578
AZN43473.1	4.42e-206	7	585	6	579
QHT62983.1	3.32e-203	7	585	6	579
AYQ71525.1	6.19e-201	7	589	6	582
AYQ73076.1	3.19e-200	7	585	2	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.18e-73	8	576	26	565	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3FN9_A	7.67e-22	54	521	39	496	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6LEM_B	7.94e-21	19	587	8	584	ChainB, Beta-D-glucuronidase [Escherichia coli]
6LEJ_B	7.99e-21	19	587	10	586	ChainB, Beta-D-glucuronidase [Escherichia coli]
6LEG_A	8.01e-21	19	587	11	587	ChainA, Beta-D-glucuronidase [Escherichia coli],6LEG_B Chain B, Beta-D-glucuronidase [Escherichia coli],6LEG_C Chain C, Beta-D-glucuronidase [Escherichia coli],6LEG_D Chain D, Beta-D-glucuronidase [Escherichia coli],6LEL_A Chain A, Beta-D-glucuronidase [Escherichia coli],6LEL_B Chain B, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	5.75e-24	11	472	43	490	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P05804	4.37e-20	19	587	10	586	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	3.64e-17	23	500	7	459	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P06760	7.36e-17	24	469	41	508	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
O97524	2.27e-16	11	469	29	511	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003179_00282.