CAZyme Information: MGYG000003416_00221

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae
• CAZyme ID: MGYG000003416_00221
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	MGYG000003416_159|CGC1	69320.01	6.8456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003416	1989769	MAG	Fiji	Oceania

• Gene Location: Start: 1698; End: 3506 Strand: -

Full Sequence      

MFKEIDFNYHKVQGNIMTPWGEKLRADNVLPEYPRPQMVRDKWMNLNGLWDYAITAMDQE
SPKSYDGSILVPFAIESALSGVKKPLLPTERLWYRRSFKLPESFKEDRILLHFGAVDWKA
EVWINGIQVGEHTGGYYPFSFEITEYLKVGDNEIVVGVWDPTDSYGQERGKQSLKPKSIF
YTPVSGIWQTVWLEAVPKSYIKSFKITPDIDREQVTLEINAESPSGAMIEVSIYEEGIKV
SSARKGLGQALSIGVKSPRLWSPASPFLYDLSISLVINNEIVDKVKSYFAMRKFSVDKDE
QGFARLFLNNEPLFQNGVLDQGYWPDGLYTAPSDEALRFDVEITKRLGFNMTRKHIKVEP
ARWYYHCDRLGLIVWQDMINGGGPTKTIYHMAITNFLRMTTLKDSNYRRHGRQLQENRDN
YMKELKEMVDALYNVPSIGLWVPFNEAWGQFDGEKVYKWLKSYDATRPIDHASGWQDQGS
GDLKSEHIYFKKLFLPKDRKGRVLAITEYGGYSLAEQGHLWQTDKAFGYKGYQSKEELTK
AYVDLINKQLKPLISRGLSAAVYTQLTDVETEINGFVTYDRRVIKMDEKQVAEANNIADI
VL

Enzyme Prediction     

No EC number prediction in MGYG000003416_00221.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	35	486	1.5e-112	0.49601063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.08e-36	46	469	15	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.93e-30	45	515	14	515	beta-D-glucuronidase; Provisional
PRK09525	lacZ	4.38e-26	94	469	124	485	beta-galactosidase.
PRK10340	ebgA	1.87e-23	85	467	102	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	6.47e-20	46	197	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRN83171.1	5.18e-224	16	595	13	591
AFL77743.1	1.82e-218	16	595	29	597
ASV76035.1	1.57e-217	16	594	33	579
SMX54984.1	1.23e-215	18	596	15	592
SCM57946.1	4.04e-214	16	595	28	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	7.15e-192	16	595	12	579	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5UJ6_A	7.88e-32	37	446	28	418	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	7.96e-32	37	446	36	426	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	7.93e-31	37	446	36	426	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
5T98_A	9.31e-28	93	468	87	446	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	7.63e-33	93	512	59	457	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	9.44e-30	93	513	106	520	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	2.73e-28	93	542	109	518	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q48727	8.33e-28	45	522	39	525	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3
Q03WL0	1.47e-26	10	522	11	549	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003416_00221.