CAZyme Information: MGYG000003513_00012

Basic Information

• Species: Prevotella sp900769055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769055
• CAZyme ID: MGYG000003513_00012
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37396.16	6.4991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003513	2720584	MAG	Fiji	Oceania

• Gene Location: Start: 36; End: 1037 Strand: +

Full Sequence      

MDITGYNYLIDKAEADHQRVPSRVMMQTESYPRDAFSNWTASTDHIYIIGDFVWTAIDYL
GESGIGRYWYEGDPVGEHWERPLYPWHAAYCGDIDLTGRLKPIGHYRNMLWNDNEKLYMA
VREPHGYQGKGKITAGMWAVHPTWESWNWEGWEGRNIDVEVCSRYSSVRLYLNDQLIGEK
PTDRTTEFKAVFTIPYTAGTLKATGMENGVEKETAILTTTSEPYAIRMTADAQTIKAGCQ
DMAFVKVEVVDRQGRLVPNASNLISFSVKGAGTIQAIGNADITDTTPFTSHSWKAWKGEL
LVAVRSGDKAGTITLNATAKGLRGCSQRIKVTK

Enzyme Prediction     

No EC number prediction in MGYG000003513_00012.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	5.25e-44	226	326	1	101	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam16355	DUF4982	8.76e-16	154	211	1	58	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
smart00634	BID_1	6.65e-05	229	321	6	84	Bacterial Ig-like domain (group 1).
pfam02369	Big_1	0.004	240	317	4	64	Bacterial Ig-like domain (group 1). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial surface proteins such as intimins and invasins involved in pathogenicity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36407.1	2.45e-129	2	333	466	796
AOZ98904.1	1.30e-128	2	333	490	819
QDW22435.1	7.73e-128	2	333	479	808
AII67270.1	2.28e-127	2	333	483	812
QJR57425.1	2.28e-127	2	333	483	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.07e-61	1	322	452	768	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.11e-61	1	322	452	768	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	1.59e-33	26	322	515	792	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T9A_A	2.21e-33	1	331	522	845	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.31e-30	26	329	521	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.63e-27	44	323	603	840	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KN75	6.64e-13	147	330	613	794	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003513_00012.