CAZyme Information: MGYG000004179_00242

Basic Information

• Species: UMGS1241 sp900550525
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UMGS1241; UMGS1241 sp900550525
• CAZyme ID: MGYG000004179_00242
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000004179_3|CGC1	65615.26	7.0107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004179	1905126	MAG	United Kingdom	Europe

• Gene Location: Start: 27878; End: 29626 Strand: -

Full Sequence      

MSGQAGPRGAVLPEYPRPQLRRDSYLNLNGLWEYAITGSDAQPETFDGEILVPYSPEAPL
SGVGRSPGPDQFLWYRRRVALPEGFVRARTLLHFGAVDQEAAVFVNGEQLAHHIGGYLPF
SCDVTDALHGATEMEIVVCVRDRTDASYHTRGKQKRAHGGIWYTPQSGIWQTVWMESLPK
THIRSLRITPLFEQAAVELRVQTSVPCACVARLDGRTVTFCSGTSVRVPMPGFRPWSPED
PYLYDLAVEAGEDRVESYFAMRSFGVGPDEDGLPRLLLNGRPYFHTGVLDQGYWPDGLYT
APSDAALEADIALMKRMGFNMLRKHIKVEPLRWYYHCDRLGMLVWQDMPNGGGAYRLSTI
SLPLLTNRHRDDRDYAAFARQEEAGRREFSRELQQMVEHLYNCPCIAMWVPFNEGWGQFD
ARETAARLRALDPTRTIDHASGWHDQGAGDVKSLHVYFRPYRHKQEPGERAVVLSEFGGY
HLRIAGHADGSRMFGYRRCKSQEQLAFLIQDLYVRQIIPAKAQGLSAAVYTQLSDVEGER
NGLVTYDRAVVKMDEAAMRALNDALRGDGRPASPAPEPHRMR

Enzyme Prediction     

No EC number prediction in MGYG000004179_00242.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	461	1.6e-104	0.5026595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.18e-40	15	437	3	445	beta-D-glucuronidase; Provisional
COG3250	LacZ	8.20e-33	28	437	15	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.10e-17	25	453	41	487	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	9.80e-13	74	179	68	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	1.12e-11	167	417	207	466	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXO33549.1	2.80e-244	11	566	16	581
AOH43755.1	5.02e-244	10	566	13	570
ACZ86262.1	8.36e-241	10	566	15	582
ADU07015.1	1.23e-240	11	565	16	580
AXH90955.1	1.74e-240	11	565	16	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.25e-135	11	565	25	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C71_A	2.04e-30	3	476	27	521	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
5C70_A	4.32e-30	6	476	4	496	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
6U7I_A	7.73e-22	11	414	2	412	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
5UJ6_A	1.16e-20	74	414	79	418	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R5N6	1.93e-19	9	548	26	613	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2
P08236	1.93e-19	6	548	22	613	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2
P77989	2.24e-19	74	511	59	482	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
O77695	9.92e-18	15	548	26	610	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
P05804	3.70e-17	73	437	67	441	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004179_00242.