CAZyme Information: MGYG000001320_00335

Basic Information

• Species: Peptacetobacter hiranonis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter hiranonis
• CAZyme ID: MGYG000001320_00335
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1121		125066.16	8.6402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001320	2423386	Isolate	not provided	Asia

• Gene Location: Start: 12603; End: 15968 Strand: +

Full Sequence      

MGRFRKAIATMLVACMTMVTPASLGMTKVSANEANKTKMSVYSIDAGRKFFSVNQIKEII
DTANKTGYTHVQLLFGNDGLRLVLDDMTITANGKTYASDDVKEAIKSGTKKYYDDPNGTV
LTQKDMEAILAHAKSKNVKIIPVISSPGHMDAILNTMEALGIENPKFNYQGTVSKTTLDL
NNAKAVEFTKELVEKYAKYFNGKVEYFNFGADEYANDATYHGPSKKSGFLVLQEEKLYDD
FIKYINEISAMVKENNMKPICFNDGIYYNQDEKNGTVDTDITVAYWTPGFDRYSPAPAKY
LIEKGFKILNTNDNWYYVVGRNGEGWWYGSAMATDSMKKFKFNRVVGTADNEKPLPIVGS
MACTWCDEPQKEYKPEIVKGLMELFANQNKDYIYPKANYAKVEDAIKKAPKDLTKYTEET
AYNLNRAIASVTYGEKLADQAKVDAMANEITKATANLKVATSKKKKSAIFSIDAGRKYFS
KDQLIEIIEKAHRNGYTDVQLILGNDGLRFALDNMDIKVNGKTYKSEDVKKAITKGNDIY
YKDPNGDYLTEAEMDEILTVAKRLGMGVIPVINSPGHMDGILNAMEALGIKNPQYSHNGK
KSTRTIDLNNKEAIEFNKELVKKYATYFAKKGSKIFNFGCDEYANDIDSSEEGYYNGWSR
LQGEGMYPKFVTYVNDLSKVIKDAGMKPMCFNDGIYYNKKDEYGKFDKDIIISYWTAGWW
EFYTAPAAYLYDKGHQIVNLNDGWYWVLGSYKNEANKLPYKYEDAMANIEKFDFNKVAGD
SLGVPTIASMQAVWCDDPAQKHEMDKVMNLMDAYSAKHTGYLKRPGMKVNVAERIEGETR
YETSLEVSKKAFSKSEKAYLVSGEKFPDALSAASLTSEGNGPILLVNDKTIDKVLAEVDR
LNAKEIVLVGGGSISASNKNKVKEFAKSHSATVSELAGKDRFDTAVKVANKTITTLGNKG
KVIIADGRNYPDAVSIAPYASKEGIPVLLANGNNVSKEVKDFLAKNNIKEAIIVGGDKAV
GKDVEKLFKKVDRISGANRYETSAKIAEKFFASTDGIFMASGEAFADSLSVSYYASQKNT
PVVLTIPNRLHDNTRKYMENNKYKNYYVIGGEAAVTSNIFR

Enzyme Prediction     

EC	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	42	373	1.6e-51	0.884272997032641
GH20	470	806	2.1e-42	0.8961424332344213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06564	GH20_DspB_LnbB-like	8.25e-85	38	392	1	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	3.18e-83	469	821	4	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	9.86e-77	43	800	16	722	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
COG3525	Chb	1.08e-27	39	379	425	730	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam04122	CW_binding_2	8.70e-22	1033	1118	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK21709.1	0.0	1	1121	1	1121
QQQ86831.1	0.0	1	1121	1	1121
QKL32253.1	6.48e-239	20	823	137	951
AQA08098.1	1.61e-238	19	823	137	942
VFI19059.1	5.43e-238	38	823	168	962

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7PUL_A	6.75e-125	468	822	11	350	ChainA, Beta-N-acetylhexosaminidase [Enterococcus faecalis]
4AZI_A	6.34e-124	38	462	9	424	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZI_B Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
2YLL_A	3.94e-121	23	452	11	442	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4]
2YL5_A	1.43e-120	38	462	9	424	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],2YL5_B Inhibition of the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],2YL5_C Inhibition of the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],2YL5_D Inhibition of the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],4AZC_B Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZC_C Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZC_D Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
4AZC_A	1.43e-120	38	471	9	426	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49610	3.40e-232	38	823	186	980	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2
Q02114	7.10e-41	830	1119	26	309	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q02113	1.02e-28	815	1119	45	338	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
P13723	5.54e-07	29	316	147	398	Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999015	0.000213	0.000183	0.000149	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001320_00335.