CAZyme Information: MGYG000003279_00031

Basic Information

• Species: Alistipes sp900541585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900541585
• CAZyme ID: MGYG000003279_00031
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946	MGYG000003279_1|CGC1	105373.99	6.2213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003279	3216844	MAG	United States	North America

• Gene Location: Start: 41440; End: 44280 Strand: +

Full Sequence      

MKKLHRFIICCSLCFCCGTAMAVVDIVPKPFFAEETGNVLMLGPKIRVFARTAELESVVR
VWKESLCKPYAPGVSETAAGFRRIVSDATLPGIVLSAKARNADVCLSVDAKLAAEEYVLE
ISSEGIAIRGGSPSGVRWGLQTLSQVLIGRANEQPGNETLRLSGLRIADKPRFAYRGAML
DCCRHFFTVEEVKSFIDVMFLHKLNTFHWHLTDDQGWRIEIRKYPLLTQIGSMRKETLIG
HIQKSKEYDGTPYGGYYTQDQIREVVAYAAARGITIVPEIEMPGHAQAALAAYPHLGCRG
EGYEVRTTWGISKEVVCLGNDAVYDFFRDVLDEVAELFPGEIIHIGGDEAKADNWKQCPK
CQARLRELGLESERQLQGHLVAKMEEHLRSRGKRILGWDEILTAGVTSGAIVMSWRGPAG
GIKAASMGNDVVMAPNTSFYLDYYQTTDPAANGEPLAIGGSLPMEKCYAFEPFEQLDEYT
KHHILGLQANLWTEYIDSFDKVQYMLLPRLAALSEIAWSETKDTYDSFIARVRCGFVPVY
QYFGLIYAPYAFARANFDEAAIRPYVLPDVLKQADGRVVRTANQWERVRRPELLSVFRRQ
MYGTLPGTDVEVTSKCLEESADAVGGKATRRQVELTFARNGVERKAILLIYLPNGVEGPV
PCFLGFNFQGNQTTSFDPAVIPSQYSEYPVGNRDSRWDVESVVDAGYALVTAHYYDFFYD
REDDDFEGKYPKSIFALFGRNSSAGFSGTEGRAISAWAWGYSRVLDYLAGSEERIDPSRV
AVMGHSRLGKAALWAGANDPRFALVISNDSGCCGAALSKRRIGEDLHRILRFRHWFCKDF
DKYADNEEALPFDQHELLALIAPRPLYVASAAGDVWADPKGEFLAAAEASRVYALYGLEG
LPVDGIPSVGVPLHGGRVGYHIRDGKHDVTPLDWTHFISFADKQLK

Enzyme Prediction     

No EC number prediction in MGYG000003279_00031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	168	520	3.2e-123	0.973293768545994
CE15	567	946	7.1e-86	0.9888475836431226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	173	532	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	7.61e-163	173	519	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.87e-115	112	556	203	651	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	1.27e-99	173	532	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	6.63e-92	173	526	1	303	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64276.1	3.88e-175	1	552	1	520
BBL15856.1	1.40e-167	24	552	16	515
CBK63833.1	2.59e-167	26	552	26	523
AFL77431.1	2.59e-167	26	552	26	523
BBL03667.1	5.55e-167	24	552	16	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	1.14e-141	115	557	106	547	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	1.66e-107	92	526	55	491	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
3RCN_A	2.10e-105	97	549	60	515	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
6SYR_A	1.71e-98	555	946	24	427	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6GRW_A	8.67e-98	565	946	5	398	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	3.84e-129	24	532	35	518	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	1.26e-106	92	526	74	510	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
A0A0K2VM55	1.08e-85	556	945	31	427	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
P96155	3.71e-85	101	514	194	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	7.58e-68	112	519	55	448	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001715	0.678209	0.318835	0.000603	0.000334	0.000282

TMHMM  Annotations     

start	end
7	24