CAZyme Information: MGYG000000002_01677

Basic Information

• Species: Blautia_A faecis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A faecis
• CAZyme ID: MGYG000000002_01677
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		61071.63	5.0002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000002	4433109	Isolate	United Kingdom	Europe

• Gene Location: Start: 104363; End: 106054 Strand: -

Full Sequence      

MPKTALMGSPLAVIGTVFRHRRTLAKTGAAVGGVLMLPILFLVMLPGLVFGDLSENTGAL
TSNTVISENIRASNQAIVEVLQESHDALLAKINAEIARLPEGDTASISDPYASSIIVNAN
QLIAQFCASQDDYKNINISKLKSLIRENEDGLFSYDVTSETATVEVPAEEENAPPRKVTF
TRHTYTVSYAGDAYFADHVFHLTDKQKKTADSYVENLTMFFGGSASGLAMAVGVSDEVLA
YRATIQQVAQKYGMEAYVELLMAVMMQESGGRGSDPMQAAEGGFNKKYPHVPNGITDPAY
SIECGIQELKYALDKAGCTGPTDLDRIKLALQGYNYGSGYIDWAMERDGGYTKENAIAYS
DMMCARPNWHYDRYGDKEYVEHVLRYYQITNTGGSYPANGMQIPHYLQTDYGNIPYGGGS
IASSGCGPTSFAMIASYLTGNTITPPDAVAWCGNSYYKPGVGTYWSYFQAAASHFGCGSV
TQTSNANTVLQALSEGCPVISSQRAGLFTSGGHFIVLRGVTANGKVLVNDPNDSDAKNYI
NREFDMMSEIHATANAYWIFDKK

Enzyme Prediction     

No EC number prediction in MGYG000000002_01677.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	1.07e-55	241	388	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	2.23e-51	235	387	1	165	Lysozyme-like.
cd02549	Peptidase_C39A	1.31e-21	425	544	6	126	A sub-family of peptidase family C39. Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic). The cleavage is mediated by the transporter as part of the secretion process. Bacteriocins are antibiotic proteins secreted by some species of bacteria that inhibit the growth of other bacterial species. The bacteriocin is synthesized as a precursor with an N-terminal leader peptide, and processing involves removal of the leader peptide by cleavage at a Gly-Gly bond, followed by translocation of the mature bacteriocin across the cytoplasmic membrane. Most endopeptidases of family C39 are N-terminal domains in larger proteins (ABC transporters) that serve both functions. The proposed protease active site is conserved in this sub-family of proteins with a single peptidase domain, which are lacking the nucleotide-binding transporter signature or have different domain architectures.
pfam13529	Peptidase_C39_2	3.05e-16	402	531	1	139	Peptidase_C39 like family.
pfam12385	Peptidase_C70	2.36e-11	413	532	6	126	Papain-like cysteine protease AvrRpt2. This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes. Papain-like cysteine proteases play a crucial role in plant-pathogen/pest interactions. On entering the host they act on non-self substrates, thereby manipulating the host to evade proteolysis. AvrRpt2 from Pseudomonas syringae pv. tomato DC3000 triggers resistance to P. syringae-2-dependent defense responses, including hypersensitive cell death, by cleaving the Arabidopsis RIN4 protein which is monitored by the cognate resistance protein RPS2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT48860.1	0.0	1	563	1	563
QHB23689.1	0.0	5	563	38	607
ASM68260.1	0.0	5	563	38	607
QEI31189.1	0.0	5	563	38	607
CBL21023.1	3.33e-310	5	563	38	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	8.06e-12	232	424	20	216	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.91e-10	210	394	2	184	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	2.47e-26	221	386	40	191	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	6.71e-16	234	383	48	200	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
Q99ZN9	4.90e-10	236	365	28	148	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q5XC63	1.65e-09	236	365	28	148	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	1.65e-09	236	365	28	148	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997643	0.002248	0.000015	0.000011	0.000006	0.000085

TMHMM  Annotations     

start	end
28	50