CAZyme Information: MGYG000000005_00201

Basic Information

• Species: Terrisporobacter glycolicus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter glycolicus_A
• CAZyme ID: MGYG000000005_00201
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000000005_1|CGC1	21361.27	4.9717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000005	3930428	Isolate	United Kingdom	Europe

• Gene Location: Start: 222723; End: 223280 Strand: +

Full Sequence      

MYKKSIIILSVIIVLGGAIYLEGGRIKTLLYPKKYSAYVQKYAEEYNLDENLVYSIIKAE
SKFNEEALSRRGAKGLMQIADVTRDWAIEELELSDDIDVYDPETNIRIGCWYLNTLYKEF
GKTDLVVAAYNGGSGNVRKWLSDEEFSKDGENLHTIPFSETDKYVIKVKKNYEQYNMLYS
KEGRN

Enzyme Prediction     

No EC number prediction in MGYG000000005_00201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	176	1.1e-28	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.31e-69	32	173	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.55e-42	30	178	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.45e-32	50	173	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	2.26e-31	37	173	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	1.21e-29	31	185	135	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK99408.1	2.36e-89	1	185	1	184
AVD40846.1	2.36e-89	1	185	1	184
QQY50391.1	2.36e-89	1	185	1	184
QQY75444.1	2.36e-89	1	185	1	184
QQY70836.1	2.36e-89	1	185	1	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.37e-19	28	179	409	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.37e-19	28	179	413	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.38e-19	28	179	419	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.39e-19	28	179	423	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.39e-19	28	179	429	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	3.38e-16	31	179	476	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.38e-16	31	179	476	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	4.60e-16	31	179	476	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	9.86e-16	31	174	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	9.86e-16	31	174	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.699658	0.265683	0.032372	0.000573	0.000361	0.001366

TMHMM  Annotations     

start	end
5	24