CAZyme Information: MGYG000000010_01210

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_01210
• CAZy Family: GH23
• CAZyme Description: Chromosome partition protein Smc

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1955		211254.09	10.3801

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 67197; End: 73064 Strand: +

Full Sequence      

MANERMEGLTLEMKLDSVGVSEGLKGLKRELGVVNSEMKANLSAFDKSDRSMQKYQTRLD
GLNTKLTVQKKMYSQAKQELKDLNTSYKNAGTEIKKVETQLSKLTDEHKKNDQALKKSND
EIKKSNDGLKKARMQQKVVNDEKTKAKQKLDQLRQTEMQLRNSGKATTDQIKKASNATKQ
QRQVHQNLVEQYKKERATVKQLSDTHKRLKGENDKVKQSYKQSNAELKNTQNQHKKLNKE
IQDYTKNQAEATKKINNEKASLNNLEKAIEKTSNEIKLFNKEQALANSHFTKTADKFDKL
SDSYSRFGMGLQSVGRNMSMYVTTPIVGALGYASKLGVEFDDSMRKVQATSGASGKQLDQ
LKAKAREMGATTKFSATDSAEALNYMALAGWKTNDMVKGLPGIMNLAAASGEDLAQVSDI
VTDGLTAFGLKAKDSGRFADVLAAASANANTNVLGMGEAFKYAAPVAGALGYTIEDTSIA
IGLMSNAGVKGQKAGTALRTMFTNLAKPTKAMKNQMEELGITITDSNGEMLPMRDVLDQL
REKFSGLSKDQQASAAATIFGKEAMSGALAVINASESDYTKLSKAIDKSEGSATAMSKTM
ESGLGGSLRELRSAAEELGLSIFESVQPALKGMVSGLKNTVDYLNGLPKGAKLAAVGFGV
ITAAIGPLLLGTGLLIRGIGSAMKGYAGLNRVMAKNSVEAGINAAAHSAAGTSMVKTTAK
NNKGLSRFTSLIGLSGKSTGKLSTVLRVGSKGLGVFGLAITAVAGTLTYAYKNIDWFRSG
VQSLGTFLKEVGSSIDWSWISDSAKWFKKAGSATKDFGTKLLELNPYMQLAKLYFGKLDD
AVSKSTDTVDIYGEGVSKGTKKALSKYTDLSEKAKVKLEEIRISHDVIGKEQYKTVSDLY
SNINKEVENQLEQRHDKEIGKLTKLFKESDALSGKREQEILQKTKDAHQKELDETQKVND
QIQEIYKTAKDEKRALTEKENEKIASLQSQLDIKVTESLSNGEKEQKVILERMKNNQSAL
SMEAASNVIKESAKSRDKSIGDAKKKRDDVIKWAIEQRDEAKTLSKDEADKIIKDANDKY
KESKDKAKLQHKKVVSEAQKQNKGVKENIDSQNGHVLSSWEKTKNKVSKHAGKMAGSAIG
SFLRTSKGATKWLGKATGTAVSKFKSISKGAGDWLGRAAGTAAGKFTSISSSAAKWLGKT
AGNALSKFTNVSSSAGKWLGKTAGTATSKFTTVWNSAKDRFNRTRDKAESSTKSVSKSAG
KWYGSAAGTAKSRFGEIWGSAKSNFTNVAEHGWNKAKSTYNGFKTWLGRTLKYIRDVGSD
MGRAASDLGIKVANNAIEGLNKMIAGVNKISAAITGDNLIKTIDTIGSAGTLGRRLSTGT
VGGDVSTDSDGALKQATMAIVNDKGPGNGTGGFTQEIIERKDGSMYMPKGKDVPVMLEPG
SKVHSGSVTQQLAKLGLLPKFSTGTPRKKRLDEQLVGAFGKLTGKTVGHGAEALDGIGTL
TDKAKGEAGKQAGKASAFVSKSVKDVWDFVDKPKELIKRVMDDFGVNFKSIPAHTGELVR
GAYKKLKSSLADKVTSMFDEFGSSGGGYNPFADWPITPGRGWKSGGHAGIDYAVPAGTKI
PSPLDGEVIQRWFSPYGGGNETQVYDGSKYTHIFMHQSKQIAKKGQRINQGDIIGLVGNT
GNSFGAHLHWQVNKGKGFRNNHPDSINPLDWVKEAMAAGGAGGKGAAYARKIIKQAQNIL
GGRYKSPAITEHMMKLAKRESNFDPKAVNNWDSNAQRGTPSKGMFQMIEPTFRANAKSGY
NKFGNTLHEAISSLQYIVRTYGWGGFPRAASAAYANGGISSTHKIAQISEGNKAEAIVPL
TKRTRAIQLTEQIMDYLGMDTGKSNVTVNNDTSVMEKLLKQLVSLNDKSNRQTDVIIKLM
KQIPEGTDISKLEPMISTLQGSRLNNANYTMGGAR

Enzyme Prediction     

No EC number prediction in MGYG000000010_01210.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01760	tape_meas_TP901	5.68e-71	323	665	1	345	phage tail tape measure protein, TP901 family, core region. This model represents a reasonably well conserved core region of a family of phage tail proteins. The member from phage TP901-1 was characterized as a tail length tape measure protein in that a shortened form of the protein leads to phage with proportionately shorter tails. [Mobile and extrachromosomal element functions, Prophage functions]
pfam10145	PhageMin_Tail	1.85e-55	362	561	1	200	Phage-related minor tail protein. Members of this family are found in putative phage tail tape measure proteins.
cd13402	LT_TF-like	5.48e-36	1751	1865	2	117	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG3953	SLT	1.23e-28	1753	1894	18	171	SLT domain protein [Mobilome: prophages, transposons].
cd12797	M23_peptidase	3.94e-26	1607	1692	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRN90722.1	0.0	1	1955	1	1972
QYG31585.1	0.0	1	1955	1	1972
ADV05786.1	2.33e-294	3	1953	2	1861
CDL65134.2	7.02e-290	24	1952	1	2103
ANQ88262.1	3.73e-285	3	1953	2	1861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2B44_A	2.82e-14	1605	1713	25	131	TruncatedS. aureus LytM, P 32 2 1 crystal form [Staphylococcus aureus],2B44_B Truncated S. aureus LytM, P 32 2 1 crystal form [Staphylococcus aureus]
2B0P_A	2.90e-14	1605	1713	26	132	truncatedS. aureus LytM, P212121 crystal form [Staphylococcus aureus],2B0P_B truncated S. aureus LytM, P212121 crystal form [Staphylococcus aureus],2B13_A Truncated S. aureus LytM, P41 crystal form [Staphylococcus aureus],2B13_B Truncated S. aureus LytM, P41 crystal form [Staphylococcus aureus],4ZYB_A Chain A, Glycyl-glycine endopeptidase LytM [Staphylococcus aureus subsp. aureus NCTC 8325],4ZYB_B Chain B, Glycyl-glycine endopeptidase LytM [Staphylococcus aureus subsp. aureus NCTC 8325],4ZYB_C Chain C, Glycyl-glycine endopeptidase LytM [Staphylococcus aureus subsp. aureus NCTC 8325],4ZYB_D Chain D, Glycyl-glycine endopeptidase LytM [Staphylococcus aureus subsp. aureus NCTC 8325]
5KQB_A	1.33e-13	1605	1709	27	131	Identificationand structural characterization of LytU [Staphylococcus aureus],5KQC_A Identification and structural characterization of LytU [Staphylococcus aureus]
6UE4_A	5.97e-13	1556	1692	229	350	ShyAEndopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961],6UE4_B ShyA Endopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961]
6U2A_A	6.09e-13	1556	1692	226	347	ShyAendopeptidase from Vibrio cholera (open form) [Vibrio cholerae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E7DNB6	4.46e-64	275	823	13	514	Tape measure protein OS=Pneumococcus phage Dp-1 OX=59241 GN=TMP PE=4 SV=1
O64314	2.80e-23	299	661	169	541	Probable tape measure protein OS=Escherichia phage P2 OX=10679 GN=T PE=3 SV=1
P45931	2.07e-17	1753	1880	1367	1502	Uncharacterized protein YqbO OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbO PE=1 SV=2
P54334	6.48e-16	1753	1880	1115	1250	Phage-like element PBSX protein XkdO OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdO PE=4 SV=2
P44693	2.10e-12	1588	1691	333	432	Uncharacterized metalloprotease HI_0409 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0409 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
654	676
752	771