CAZyme Information: MGYG000000246_00211

Basic Information

• Species: Streptococcus pasteurianus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus pasteurianus
• CAZyme ID: MGYG000000246_00211
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000000246_1|CGC5	36722.26	6.5995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000246	2159802	Isolate	China	Asia

• Gene Location: Start: 217824; End: 218834 Strand: +

Full Sequence      

MRLKQVLLLGSLFPFLLAVTLFFGVLVSADNDDSGGNYSSGITGMNLSAEVLKHQPMVEK
YAKEYGISEYVNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFASLL
SSCKEQGITDINVAIQSYNFGGGYVGYVADNGKKHTYNLAENFAKDKSGGKKVTYTNPIA
VKKNGGWRYSYGNQFYVELVNQYLYVTQFDDETVQAIMNEALKYNGWKYVFGGSSPTTSF
DCSGLTQWCFGKAGISLPRTAQAQYDATQHIPITQAKPGDLVFFHSTYNAGSYVTHVGIY
VSPTQMYHAGSSGIGYTDLTSSYWQQHLIGAGRVKQ

Enzyme Prediction     

No EC number prediction in MGYG000000246_00211.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.29e-73	48	204	1	165	Lysozyme-like.
cd16891	CwlT-like	5.28e-68	54	204	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK13914	PRK13914	1.73e-36	213	334	365	481	invasion associated endopeptidase.
pfam00877	NLPC_P60	7.10e-36	226	333	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	2.85e-25	213	331	74	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQU11030.1	5.53e-241	1	336	1	336
BBK21191.1	1.11e-240	1	336	1	336
QQV05521.1	3.39e-215	1	336	1	338
ASU18235.1	7.60e-209	1	336	1	335
ANU69332.1	7.60e-209	1	336	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.98e-185	29	336	2	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	8.90e-141	30	334	2	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	1.63e-14	226	334	26	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6BIQ_A	6.15e-13	226	321	167	264	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]
2HBW_A	9.15e-13	229	334	114	226	ChainA, NLP/P60 protein [Trichormus variabilis ATCC 29413]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	3.86e-74	13	335	16	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	1.15e-27	217	334	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01836	6.56e-27	216	334	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
Q01839	7.36e-27	217	334	412	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01837	1.63e-25	216	334	411	524	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001139	0.998046	0.000294	0.000179	0.000162	0.000161

TMHMM  Annotations     

start	end
7	29