CAZyme Information: MGYG000000315_00229

Basic Information

• Species: UMGS951 sp900547585
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS951; UMGS951 sp900547585
• CAZyme ID: MGYG000000315_00229
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000000315_4|CGC1	77101.38	9.3635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000315	1984931	MAG	Sweden	Europe

• Gene Location: Start: 30836; End: 32827 Strand: +

Full Sequence      

MKSWKQKLKFFIITGAFVALILIVFCRVFNMTSVSEKDFKTYRQGVEYLNQGDFQNAYYN
FSNISKTSKLYEIALLREAMCADSLNDHETAVRKYNTFIERYPESIFIKKVYYSLGQNYF
KQNEHKKAEKIFEKLRKLGEDDEYAIGASYYLGVINKEKNPQRAKAYFTSYLKSAPDGRF
AISSAQELENLNIPPGASDNRLIGRAYFLNGSYAKALPFLNKADMRTNWHYIFRIYHARG
SYALANKVFDEGYSKFSASIDEKELFNTLEYYAKHSGATEKDGWYNVLEKANAYNAKGAD
FASYRLARLVDKPLKEHFYHQIYKKYPDGKFASDALSNLFWIEYKNRNYVEAKKYGYLHI
KNYPKTIASARVIFWMGKISEKQGLKNEARAFYQKVLNEYPDDYYAFRAGKKLEFYQTSP
WKTKSYRSLPPFAGTIHFPIKYTSLSDENIALINTILKLDDYSLLNEVEKDNKFVQSWLN
YKEKNYSRAATLARDALADMEEKPDFSDSVYKLAYQLHYQNEINHFSSEFGLDAFLVAAL
IREESYFNPKARSSAGASGLMQLMPATAAYIAKTEGIRYSSLFNPAQNIELGCAYLSHAR
DLLNNNDLLAVASYNGGPNAVKSWKNDLNYNNMDEFIENIPYEETKNYVKKVYRTYWIYM
NMY

Enzyme Prediction     

No EC number prediction in MGYG000000315_00229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	536	657	1.1e-28	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.20e-61	514	659	1	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.34e-49	517	656	2	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.03e-38	536	657	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	1.75e-33	517	659	477	626	lytic murein transglycosylase; Provisional
COG0741	MltE	1.52e-30	519	659	139	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	1.09e-119	1	663	1	657
BAQ62516.1	1.36e-46	51	663	99	711
BAU62886.1	5.97e-43	32	663	59	688
QUS62422.1	6.71e-43	116	663	202	788
BAQ63384.1	1.73e-42	75	663	126	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	6.24e-21	531	652	461	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.81e-21	531	652	490	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.47e-20	531	652	462	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.47e-20	531	652	461	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	1.86e-19	471	652	397	591	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.09e-18	471	652	424	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.09e-18	471	652	424	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31608	2.37e-18	475	657	18	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.02e-17	471	652	424	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	1.78e-16	514	656	1417	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000032	0.000014	0.000000	0.000000	0.000015

TMHMM  Annotations     

start	end
7	29