CAZyme Information: MGYG000000491_00071

Basic Information

• Species: Zag111 sp003258735
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp003258735
• CAZyme ID: MGYG000000491_00071
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000000491_1|CGC1	78580.2	9.6614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000491	2014387	MAG	Fiji	Oceania

• Gene Location: Start: 64544; End: 66565 Strand: -

Full Sequence      

MSAKLKLVMLVFNKINKNQINKVIIFVICLILGFGFAKIYQPQGKTERLYKQALKDYQNE
NYQNSYYLFSKIGYMSSLKPMAIYRQAMCAKALGDKKSELKRYQQLFKHYSTNKLAPEAK
YQAGQIIVDENPNLALKYFQSVSKSNIDDDYKIAADYYKARIAASKIRYSNKILSRAKVA
GVEKSFRHYLQTVPDGRLAVSVAVNWKKFNPNIKSEDVIYLVRAYYLAGLYKDAMALVPK
AKTDEVWALKASSLYKLYDYQNVKNIVEEGVVKYSDNVDVSDYRRAVDDYVNLYDSQGDK
LKYTTKLLSLAKGKKKDYIWNKKCSLVQSKDKFVCYRDLYKNFPDGDFAENAMVQVFMIG
VRNKNYQKCKDLAQEFLKKYPDSKFVPQVMFWAGKIEQTYYHSPKYSEYFQNIINNYPDS
YYAYRAYWMLKGVHSSTIPAALEFKPVEYPYRYPDKNSVLYHLIEVQDYDMILKYTDDEF
IKSWVEFQKGNYATSMIIAREAMDKIKVKPPKTDLRWRLVYPQNYYKQVQNYAAQYNNND
ALMMAIIREESSFNSDAQSGVGAIGLMQLMPSTAHDIGQKHGIIFNTSYLFNPELNIRLG
NLYYSTIKGMLNNMDVSAIAAYNGGIGSVTRWKSTFLYNDTDEFVEQIPYDETKNYVEKV
FRSYWNYTRIYQK

Enzyme Prediction     

No EC number prediction in MGYG000000491_00071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	532	667	7.5e-26	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.84e-56	521	670	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.56e-44	522	664	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.13e-30	541	665	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.52e-29	525	671	139	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	3.17e-29	528	660	2	157	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	9.30e-175	30	671	20	657
QSV68642.1	6.60e-33	478	671	508	708
QSV61466.1	8.75e-33	517	671	554	708
QSV57584.1	8.75e-33	517	671	554	708
QLE43523.1	8.82e-33	517	671	556	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.13e-24	514	660	442	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.51e-24	514	660	471	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	7.41e-24	514	660	442	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	7.44e-24	514	660	443	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	2.26e-19	515	671	406	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.51e-16	529	665	64	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.65e-15	521	664	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.65e-15	521	664	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P44888	3.33e-15	463	672	382	576	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC4	6.41e-15	521	667	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996376	0.002348	0.000042	0.000005	0.000006	0.001246

TMHMM  Annotations     

start	end
20	42