CAZyme Information: MGYG000000503_00834

Basic Information

• Species: UMGS1585 sp900766355
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1585; UMGS1585 sp900766355
• CAZyme ID: MGYG000000503_00834
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635		73386.16	9.4319

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000503	1878889	MAG	Fiji	Oceania

• Gene Location: Start: 88492; End: 90399 Strand: +

Full Sequence      

MKKDKIYLTILLAIVCLISAIAVNKKLSETQDMNKYKQAITMYQAEDYQNAYYNFSAVSE
FSTLKQAALFRQARCATTLGDTHTAIRNYYILLKRFPNSPLYAISEYNLAVLLYEAQEYH
SAKRHFVHIYKHFKDKEVSIASEYYLGMLENKPELLLDYIKQSPNGRFSKSAIKTLIENN
TKLSNADNLVIANSYLANENYNEALAYYQKTSLKDSWTGYAKTLYKLGKYEEAKKITIKG
LSIYSSFVDANEIYDVIDCFVSLSDSKLTTIKYLLSVNPKAKGADYLMFLLAKYSPSAQT
SYIYEQLYTRFPDGQFSGEALYKTFYSKINQRKYKEAIKLGKLHLAKFGNTNSAPAVMYW
IAKVYEKQRMNDMARSYYKGVLSKYPDSYYAMRANAKLNKNHTMFTKNSITNKPVVFPIH
NKSEADMAVKLAKLGDYDFVQELYKNDGFVQSWIEYEKGNYTNSALLAREAMDKLEVKPN
FKDTRWRLVYPVHYYEYIKKYSNEENPIIILSIIKEESHFNPKVTSPVGAGGLMQLMPAT
ANEIAKGYGISSNLYSPSSNIHLGCLYYAKIKRTLNNKDISAIMAYNGGWASVMNWKEQL
EYVDMDDFIEKIPYPETQDYIKKVLKSYWNYCNIY

Enzyme Prediction     

No EC number prediction in MGYG000000503_00834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	497	630	1e-26	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.97e-48	490	631	2	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.09e-42	491	628	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	2.03e-30	507	629	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	8.95e-24	511	625	498	618	lytic murein transglycosylase; Provisional
pfam01464	SLT	7.96e-22	496	599	3	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	4.43e-141	22	635	28	657
BAQ62516.1	3.63e-43	60	635	117	711
ALJ69570.1	3.06e-39	149	635	181	702
QHV01864.1	3.39e-39	149	635	197	718
BAL33774.1	5.05e-39	149	635	278	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	9.60e-20	462	631	414	600	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	1.69e-19	462	631	414	600	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5O1J_A	5.91e-18	354	627	275	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	3.16e-17	506	627	430	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	3.24e-17	506	627	440	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	9.82e-19	462	631	441	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	9.82e-19	462	631	441	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.52e-16	462	625	441	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	7.14e-12	490	628	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	7.14e-12	490	628	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.516395	0.452458	0.028659	0.000679	0.000481	0.001320

TMHMM  Annotations     

start	end
7	24