CAZyme Information: MGYG000000511_00217

Basic Information

• Species: Zag1 sp900556295
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900556295
• CAZyme ID: MGYG000000511_00217
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000000511_2|CGC1	25908.53	10.1125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000511	1940210	MAG	Fiji	Oceania

• Gene Location: Start: 52803; End: 53516 Strand: +

Full Sequence      

MFSQFIQNLLNSGGQAQAMQRYAQLSNRVNAPTQEAQNPLDTIYPNNSKINSPSFEKVLQ
SSTKSNFGTLLLDPQLKSVNASIIKESPQVSLNRALEEAAALQSNITTPKTSTKSQVLNV
VNQISKKYNVDEKLVQALIKQESGFNPKARSKAGAMGLMQLMPSTAKNLGVQDPYNMVQN
VEGGVKYLKSMLNKYNGNVILALAAYNAGPNAVDKYSGVPPYKETQNYVKSILANYL

Enzyme Prediction     

No EC number prediction in MGYG000000511_00217.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	132	236	1.1e-33	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.21e-53	132	236	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.81e-50	121	236	10	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.47e-45	121	236	8	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	5.32e-37	121	228	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	7.66e-34	59	236	82	280	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38062.1	3.80e-144	1	237	1	238
QNF30947.1	7.17e-53	105	236	16	147
AJC24412.1	4.94e-51	76	236	63	228
ADP31640.1	5.90e-51	15	236	11	234
AMR63408.1	5.90e-51	15	236	11	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.05e-14	129	235	428	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.05e-14	129	235	432	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.06e-14	129	235	438	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.06e-14	129	235	442	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.07e-14	129	235	448	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	9.36e-49	119	236	62	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	7.04e-42	121	236	1426	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	7.04e-42	121	236	1426	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	3.95e-18	125	211	15	100	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P44888	3.01e-15	129	234	440	567	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000511_00217.