CAZyme Information: MGYG000000564_00476

Basic Information

• Species: Duodenibacillus sp900552915
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus; Duodenibacillus sp900552915
• CAZyme ID: MGYG000000564_00476
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	MGYG000000564_11|CGC1	56274.9	10.5209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000564	1924234	MAG	China	Asia

• Gene Location: Start: 12939; End: 14438 Strand: -

Full Sequence      

MASLRTALFSFAAGICFAASAACAETPAAAELRLADELPATEAEVSPPVDIWDRIRRGYA
MPELKNSRVSTMLRSYTRNPRHIERVFARAGKYLYHIVDEVEQRGLPTELALLPFVESAF
QPEALSHAKASGLWQFMPQTGNIYSLQQNFWKDERRDVLQSTRAALDYLEKLHAQFGDWH
LALAAYNWGEGSVYRAIRRAKARGRKADYSHLRMPRETANYVPRLEAIRQIVADPEKYGI
NLPPIENEPYFVRVTKSRDIDMKTAAELAEMDPDEFRLLNPGFNLPVIVASHNSVMLLPM
ENLEVFMDNLASWVNTGKPLSSWVLYHVKDGETLADVAAKSGMTEEELRRVNRIPKGRRV
LAGSALLVDANGQLAPEIAQEELSAGLKLSAPEVRRVVYRVRRGDSISSIAKKFGISQRS
LRRTNKLRSSKLRIGQRLVLVIPPRTVTQPPPGKNVHVVKRGETLFSIAKKYRTSVTKIR
IINSLRTTRISIGQRLKIR

Enzyme Prediction     

No EC number prediction in MGYG000000564_00476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	93	233	1.8e-23	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	6.53e-95	50	440	61	446	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	6.04e-63	101	230	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	8.26e-26	107	208	12	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.37e-18	116	224	10	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.34e-15	116	231	28	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22593.1	6.77e-183	48	498	45	504
QDA55156.1	2.15e-179	17	498	22	520
QQS89247.1	2.03e-177	40	498	57	526
ANU65188.1	4.18e-150	29	498	22	506
QQQ96345.1	4.18e-150	29	498	22	506

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	2.74e-71	45	442	53	444	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	2.74e-71	45	442	53	444	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	6.76e-32	88	201	20	134	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P54421	1.39e-09	328	499	30	193	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O31852	4.31e-07	386	499	16	132	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001096	0.482040	0.515975	0.000364	0.000273	0.000237

TMHMM  Annotations     

start	end
7	29