CAZyme Information: MGYG000000634_00166

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; SFHR01
• CAZyme ID: MGYG000000634_00166
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		74041.25	10.0751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000634	1737692	MAG	Madagascar	Africa

• Gene Location: Start: 6267; End: 8177 Strand: +

Full Sequence      

MPRVFAAQDPALMNAFEAFSKQKKGDFLNWQKEVQTPELARYLEEWHLRLFTLDSNPHDP
EILAFLKRYENSVVSERLQRDWLNALARNNAWMSVFVEFPKINEPTAENRCAFELAKTQM
GDFSLLENTKKIKTIWFQNQSPQALCQKLMGTIFQTHQISAGEVIAKARQQVEARRFSAA
QKTLLFLKPEKKLEKDFLEDDIKRAIKDSLRFLAKLPKNWEKNDVQRHLATLALARYAAK
SLDQALVQFLKIEKKFKTEEAAWVWGQMAIYAAREHQFEALNYFKTAQKHTKLSPYALEW
YARIALRFQKWKLLGQIIQKMPDNLKEQSVWTYWLGRSFAAQGKTEEAQQQYKKIAHHFH
YYANLAREELGQTITIPKSAAPPTKDEMAFVKQHAGLKRAFLLFENEMRLAAIQEWNWAI
NRFNDRQKLAAAYLAKENQVWDRAVNTAILLKREHQFELRFLAPFAEIIRPAAEEQQLDP
AWVYGLMRQESRFITNVKSHAGASGLMQLMPKTAKWVAKKIGLKDYKHAQVYDHDVNILL
GTTYMRLVLDDLDNHPLLASAAYNAGPSRAKRWRHNQIMEGAIYAETIPFDETRDYVQKV
LNNAVYYSILFNQKSDSLKHRLGVVFPRTVQTSALP

Enzyme Prediction     

No EC number prediction in MGYG000000634_00166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	475	605	1.3e-25	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	2.10e-68	460	610	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK11619	PRK11619	4.92e-49	42	618	67	635	lytic murein transglycosylase; Provisional
cd16896	LT_Slt70-like	1.14e-47	464	603	3	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.15e-35	331	619	3	295	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	3.65e-33	480	604	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM18154.1	1.40e-181	7	629	21	633
QKV58425.1	2.41e-177	7	629	21	634
AXS81293.1	4.67e-177	9	629	23	633
QRJ64322.1	3.56e-166	6	628	23	636
QKS28599.1	2.95e-160	38	629	59	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	9.62e-93	58	625	35	573	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.25e-92	58	625	45	583	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.39e-92	58	625	49	587	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.62e-92	58	625	55	593	Lytictransglycosylase in action [Neisseria meningitidis]
5O2O_A	2.69e-92	58	625	75	613	Lytictransglycosylase in action [Neisseria meningitidis],6H5F_A LtgA disordered Helix [Neisseria meningitidis NM422]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.21e-36	62	614	85	632	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	7.27e-36	62	614	85	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	7.27e-36	62	614	85	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	1.39e-24	308	618	252	583	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.68e-14	469	608	64	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000634_00166.