CAZyme Information: MGYG000001094_00115

Basic Information

• Species: Azonexus sp900549295
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; Azonexus; Azonexus sp900549295
• CAZyme ID: MGYG000001094_00115
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225	MGYG000001094_9|CGC1	24958.05	10.5595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001094	3284523	MAG	Sweden	Europe

• Gene Location: Start: 7891; End: 8568 Strand: +

Full Sequence      

MATVTTPYAALLVCLQRLNSESILRRISRVLPVLLLFWLVSLAAVAQTVPQAALKHRASL
TRIAHAAWGLDAPIAVFAAQIHQESGWNPEAVSRVGAMGMAQFMPATARWWCEINGLGAA
ECQPTNPTWAMRALVGYDLWLFQRVRGPSEFDRLWAALRAYNGGLGHWQQEAAKIRPALD
RQMVDSACGKARRHPSHCAENLGYPRRILILLQPRYLAWGRGVSA

Enzyme Prediction     

No EC number prediction in MGYG000001094_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	75	185	1.6e-18	0.725925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	2.47e-19	78	174	16	108	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	2.78e-17	68	167	1	97	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.42e-16	62	167	2	98	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	5.49e-16	75	166	2	83	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	3.41e-12	54	167	2	108	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCB28410.1	1.93e-111	49	225	43	219
AST88009.1	1.73e-105	35	224	20	209
CBJ40034.1	1.59e-103	35	224	19	208
API77982.1	4.72e-103	18	224	1	209
QHB59567.1	6.70e-103	49	223	34	208

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	8.75e-07	76	181	306	403	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
B4RVK5	8.81e-07	76	167	309	393	Membrane-bound lytic murein transglycosylase F OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=mltF PE=3 SV=3
Q9CPJ2	9.02e-07	76	167	305	389	Membrane-bound lytic murein transglycosylase F OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltF PE=3 SV=2
A1JKM2	2.94e-06	76	167	305	389	Membrane-bound lytic murein transglycosylase F OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=mltF PE=3 SV=1
B0UUK3	5.29e-06	76	167	303	387	Membrane-bound lytic murein transglycosylase F OS=Histophilus somni (strain 2336) OX=228400 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999889	0.000115	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	49