CAZyme Information: MGYG000001277_00527

Basic Information

• Species: Bilophila sp902373525
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp902373525
• CAZyme ID: MGYG000001277_00527
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226	MGYG000001277_4|CGC1	24473.29	8.9456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001277	3409168	MAG	Italy	Europe

• Gene Location: Start: 50550; End: 51230 Strand: -

Full Sequence      

MIRFSCCFLMLVLLSGTASAGVILNEEMSTDERPAQRLQRVRPGQTGPSVPAAPLPSENL
LDRMDIYALSPHAASLALPRMVSPQLVLRAHAGKGKLPPPSVWKALVAKASSRYGLDPRL
IAAVIKVESNFENIAESDKGAQGLMQLMPQTQQYLGVVDPFDPEANVDAGSRYLRQQIDR
FGRIDLALAAYNAGPGNVIRYGGIPPFAETRAYVSKVLALAEKHPE

Enzyme Prediction     

No EC number prediction in MGYG000001277_00527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	116	223	1.4e-33	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.19e-47	104	218	5	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.85e-46	118	219	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.06e-36	100	219	3	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.22e-32	109	213	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.69e-31	109	205	3	113	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP88368.1	3.04e-61	57	218	288	446
AAS94339.1	3.04e-61	57	218	288	446
ABM29992.1	9.02e-61	56	218	275	434
CAJ55223.1	1.18e-57	58	219	71	230
AGC50601.1	1.18e-57	58	219	71	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.24e-11	101	221	414	552	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.24e-11	101	221	418	556	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.25e-11	101	221	428	566	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.25e-11	101	221	434	572	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.25e-11	101	221	424	562	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.13e-38	107	220	64	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.82e-34	103	219	1422	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.82e-34	103	219	1422	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	5.86e-21	103	218	7	116	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
B3PLH7	8.66e-11	103	198	295	397	Membrane-bound lytic murein transglycosylase F OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000907	0.998258	0.000293	0.000187	0.000170	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001277_00527.