CAZyme Information: MGYG000001320_00210

Basic Information

• Species: Peptacetobacter hiranonis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter hiranonis
• CAZyme ID: MGYG000001320_00210
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186	MGYG000001320_4|CGC1	21718.98	9.0053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001320	2423386	Isolate	not provided	Asia

• Gene Location: Start: 45786; End: 46346 Strand: +

Full Sequence      

MKNKSSIKVILVLILFSIIFIGFNFKSIEEMFYPRRYSEYVQKYSKEYNIDEYLVYSVIK
AESKFIPDAQSHKGAKGLMQISDTTAKWAEKEIGIDSKKIFEPETNIKAGCWYLARLYKE
FGKRDLVIAAYNGGSGNVRKWLEDEEYSKDGVNLHDIPFEETLKYVDKVNNNYSMYKKIY
CGKEAK

Enzyme Prediction     

No EC number prediction in MGYG000001320_00210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	177	3.7e-31	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	7.08e-72	34	175	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.04e-51	33	179	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	7.39e-38	54	173	3	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.98e-35	33	186	135	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	7.33e-32	39	174	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK21465.1	1.68e-133	1	186	1	186
QQQ87095.1	1.09e-129	1	185	1	185
QPK99408.1	1.73e-75	8	186	4	183
AVD40846.1	1.73e-75	8	186	4	183
QQY50391.1	1.73e-75	8	186	4	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.01e-22	33	180	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.02e-22	33	180	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.03e-22	33	180	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.04e-22	33	180	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.05e-22	33	180	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	2.55e-17	33	174	1418	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.55e-17	33	174	1418	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
A7MLX9	6.09e-14	36	178	192	359	Membrane-bound lytic murein transglycosylase C OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mltC PE=3 SV=2
Q2NRB3	8.22e-14	36	178	190	357	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1
A9MQR3	3.98e-13	36	178	192	359	Membrane-bound lytic murein transglycosylase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.724538	0.247652	0.017569	0.001106	0.000689	0.008462

TMHMM  Annotations     

start	end
7	25