CAZyme Information: MGYG000001608_00748

Basic Information

• Species: Gabonibacter sp900543425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter sp900543425
• CAZyme ID: MGYG000001608_00748
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000001608_3|CGC2	38334.72	9.1436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001608	3329116	MAG	China	Asia

• Gene Location: Start: 182956; End: 183954 Strand: +

Full Sequence      

MTIAIHARKIGINVLYSKIKIEKNVKKETIIKILFFIVLLDTAAIIYLIYRPATLEVQHV
SKVVPMLKPSDIYCPETFNLAGEYVPLKRTDIAESFRKELIVNTYLHSHTIQILKNVSRY
FPIIEPILEEEGIPDDFKYLAVIESSLNPLAVSPAGAVGLWQFMSGTAKELGMEVNKIVD
ERYHIEKSTRAACAYLKKAKEKFGSWVMAAASYNAGMNMLTRQINIQKENNYYDLLLGEE
TGRYVFRIMAMKQIIEYPHLYDFHVSEKYEPEKCDDIKVDKNIKDLAHFANTHGISYKTL
KRFNPWLRANTLHASEKKSYYIAIPCHPEKYR

Enzyme Prediction     

No EC number prediction in MGYG000001608_00748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	120	262	3.2e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.42e-64	128	253	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.03e-26	123	235	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	7.18e-23	140	250	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10783	mltD	4.07e-22	92	332	80	319	membrane-bound lytic murein transglycosylase D; Provisional
cd13401	Slt70-like	4.38e-21	120	250	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51442.1	4.10e-138	26	332	2	308
AZS32129.1	8.25e-138	26	332	2	308
ADY32428.1	6.24e-114	70	332	49	311
SNV32652.1	6.24e-114	70	332	49	311
AHW59007.1	4.40e-97	36	325	12	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.54e-21	92	325	77	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.54e-21	92	325	77	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	1.17e-06	144	232	85	171	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999936	0.000074	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
33	50