CAZyme Information: MGYG000002134_00213

Basic Information

• Species: Mailhella sp900541395
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900541395
• CAZyme ID: MGYG000002134_00213
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		66975.56	10.1196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002134	2752742	MAG	United States	North America

• Gene Location: Start: 75844; End: 77688 Strand: -

Full Sequence      

MSDRLSTFRPKGAALRLALCVCCALLLAGCGTAKLDVPEAPLAVNTPTDEEMLESYRLAL
QDDGRPLSDVEMRALLSTGEVDRGLSTEEMREVQVYFKHYVHSARPVVERFIRRGQPYID
YTRRVFRERGLPEELAYLAFVESGYNPVAVSRSNAVGMWQFMAPTGRQYGLQQDWWMDER
RDPYRSTRAAAEYLAKLYGDFGDWHLAVAAYNAGEGKIGRALEGTQTDTFFALCRNNALL
DDKAQLKEETRQYVPRFLAMCKIMRNADVLGFRPAEMAEDERVLLPAVELSARPGTDLAA
LATKLGMSWDEFAAYNPAFRRYITPPDRYVSVYVPRYAQAQASLLLRDASLSGSGWTTYT
VAKGDSMSRISKRTGVPVTVLRQLNRKSEPLKAGAKLRIPGRAGATLVASTPAKPASGKA
RSSTRTAPATATATKHKVQSGDTLGALALRYGVSVAALSAANPQLKDPRSMRVGQVLNVP
GTSAPAAARTVARAPAETTPAPSVTKHKVQSGDTLASLARRYKVGIDALSAANPQLKDPH
SLRVGQTLTVPAPGTTVAKATSGKTPTTYKVQPGDTMWAIARKFNIPPAELLALNNMEDA
SRLRPGDFVRVARH

Enzyme Prediction     

No EC number prediction in MGYG000002134_00213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	119	266	1.9e-29	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	4.07e-65	126	260	1	127	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	3.56e-57	90	455	80	424	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.46e-31	127	227	7	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	5.62e-24	350	585	324	566	1,4-beta-N-acetylmuramoylhydrolase.
cd00254	LT-like	1.18e-20	141	259	10	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP85240.1	1.44e-152	62	613	72	586
ABM29931.1	1.44e-152	62	613	72	586
AAS94525.1	1.44e-152	62	613	72	586
ABB40373.1	2.90e-119	48	607	59	537
SFV73355.1	4.97e-118	19	550	17	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	5.22e-13	435	609	43	214	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
7EYB_I	2.78e-08	135	262	30	147	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6YT5_G	2.79e-08	135	262	52	169	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.19e-37	89	479	79	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.19e-37	89	479	79	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	3.35e-17	114	222	21	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P11187	6.19e-15	417	548	144	255	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P07540	5.07e-14	435	548	162	255	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000049	0.000616	0.999360	0.000009	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002134_00213.