CAZyme Information: MGYG000002479_00291

Basic Information

• Species: Campylobacter_B hominis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_B; Campylobacter_B hominis
• CAZyme ID: MGYG000002479_00291
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36601.16	9.6624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002479	1714951	Isolate	not provided	not provided

• Gene Location: Start: 265098; End: 266063 Strand: +

Full Sequence      

MKILKILFFSIFFANFLIANPTISYINHDKILSDFDIENNQDNKKMVISIYKSIDKSDRN
LFKKIVLNKSYHTQVIRQKLDDLDAPEFMLYLAMVESQLSNKATSQVRAGGIWQFMPSTA
KKYGLTVNRHIDERRDPIVSTDAAYEYMSYLKDYFGKWYLAAMAYNCGEACLSKSIKSVG
SDDFDTLLNSNALPNETKNFVKKIIKYSYIAKNSSMIKILDKDGDKNKLIKIPVNGGEKL
ANIAKKANIPISAMKDINVHIRGVAAPKNGNYHFYIPTENYETYIANGGVEAIKEDNKAK
LNFKISNFLQEESKIQTSRLE

Enzyme Prediction     

No EC number prediction in MGYG000002479_00291.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	74	215	7.8e-26	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.13e-57	86	209	7	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	8.15e-33	68	306	90	343	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	1.35e-23	86	187	12	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.93e-13	86	207	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	6.81e-12	71	207	4	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS51166.1	9.01e-228	1	321	1	321
AKT92448.1	1.94e-89	1	289	1	290
QIX87113.1	5.51e-77	29	287	24	284
AKT90783.1	5.51e-77	29	287	24	284
QKF84260.1	1.74e-75	29	305	24	302

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.54e-25	86	294	115	328	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.54e-25	86	294	115	328	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011451	0.986636	0.001240	0.000226	0.000215	0.000224

TMHMM  Annotations     

start	end
7	26