CAZyme Information: MGYG000002494_00117

Basic Information

• Species: Citrobacter_B koseri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_B; Citrobacter_B koseri
• CAZyme ID: MGYG000002494_00117
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	MGYG000002494_5|CGC1	23204.21	9.2439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002494	4844850	Isolate	China	Asia

• Gene Location: Start: 4815; End: 5435 Strand: +

Full Sequence      

MASLFPALLLCAASVHPDTINDIARVESGFNPYAVAEIIPERERGSYGKSVISHMPKSKE
EALTVIREIENRKRRYSVGLMQITSSNFSFYSTSAEKLLDSCENLSVFEKIIVDCYKRGR
SLENALSCYYTGNFSNGKRKEKEFNNTSYVERIGYTGNEKKYVVPGTRSNGGEQRKNRSH
NASVIWPETILKSAFVDNSHPTKVIN

Enzyme Prediction     

No EC number prediction in MGYG000002494_00117.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	4.75e-47	11	153	5	138	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK13864	PRK13864	9.91e-18	11	153	37	169	type IV secretion system lytic transglycosylase VirB1; Provisional
cd13400	LT_IagB-like	3.12e-07	15	153	3	103	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW66277.1	8.82e-148	1	206	1	206
AQZ20389.1	8.82e-148	1	206	1	206
BBJ78093.1	8.82e-148	1	206	1	206
SMB39160.1	8.82e-148	1	206	1	206
ATB52265.1	8.82e-148	1	206	1	206

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C398	2.23e-20	11	153	11	150	Type IV secretion system protein virB1 OS=Brucella abortus biovar 1 (strain 9-941) OX=262698 GN=virB1 PE=3 SV=1
Q2YIT5	2.23e-20	11	153	11	150	Type IV secretion system protein virB1 OS=Brucella abortus (strain 2308) OX=359391 GN=virB1 PE=3 SV=1
Q8YDZ5	2.23e-20	11	153	11	150	Type IV secretion system protein virB1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) OX=224914 GN=virB1 PE=3 SV=1
Q9RPY4	2.23e-20	11	153	11	150	Type IV secretion system protein virB1 OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=virB1 PE=2 SV=1
P17791	8.27e-11	11	137	37	160	Protein virB1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=virB1 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.347841	0.636532	0.014683	0.000334	0.000274	0.000322

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002494_00117.