CAZyme Information: MGYG000002536_00289

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_00289
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000002536_1|CGC3	29174.8	10.7121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 331910; End: 332680 Strand: -

Full Sequence      

MSDKYKIADRHHRLRILHTVHVTEIAKLTRKFLRRDILGDYLLLSMKKMQSWLGIAVVAL
VLAGCAGSQGSHRGPKPNYSSDVLSYRAKQYMPAIKKASRRYNVDEKLITALIQVESSFD
PNAISRSNAIGLMQIKRDTAGREVFRVYKNSSGMPSKAYLLNPYNNIDTGTAYLSILRDR
QLAGIRHPKSMRYAMMAAYSNGAGALLRSFHPDKKKAIQKINRMSPEQVYSYINQQHNDA
QARRYIYKLTTVYNSI

Enzyme Prediction     

No EC number prediction in MGYG000002536_00289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	104	254	1.4e-19	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	3.66e-83	93	254	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	4.12e-77	84	251	185	351	membrane-bound lytic murein transglycosylase MltC.
PRK15470	emtA	8.10e-65	52	256	5	203	membrane-bound lytic murein transglycosylase EmtA.
pfam01464	SLT	3.28e-28	95	221	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.40e-23	87	252	135	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SBT61027.1	1.24e-181	1	256	1	256
QWK95701.1	2.03e-146	49	256	1	208
AVQ86389.1	2.03e-146	49	256	1	208
QWK98330.1	2.03e-146	49	256	1	208
QIY07541.1	2.03e-146	49	256	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	9.89e-51	78	255	161	337	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	2.76e-50	78	255	161	337	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
2Y8P_A	5.87e-50	72	249	3	179	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	7.70e-50	72	249	20	196	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	1.19e-49	69	249	18	199	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0UWE6	2.90e-55	84	249	181	345	Membrane-bound lytic murein transglycosylase C OS=Histophilus somni (strain 2336) OX=228400 GN=mltC PE=3 SV=1
Q0I513	2.90e-55	84	249	181	345	Membrane-bound lytic murein transglycosylase C OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=mltC PE=3 SV=1
A6VLS0	2.83e-54	84	249	183	347	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z) OX=339671 GN=mltC PE=3 SV=1
Q65VT8	4.29e-53	84	249	182	346	Membrane-bound lytic murein transglycosylase C OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mltC PE=3 SV=2
Q7N7I2	4.29e-53	84	251	184	350	Membrane-bound lytic murein transglycosylase C OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.845088	0.103826	0.051112	0.000001	0.000003	0.000000

TMHMM  Annotations     

start	end
51	70