CAZyme Information: MGYG000002665_00470

Basic Information

• Species: Bruticola sp900772775
• Lineage: Bacteria; Eremiobacterota; Xenobia; Xenobiales; Xenobiaceae; Bruticola; Bruticola sp900772775
• CAZyme ID: MGYG000002665_00470
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000002665_12|CGC1	35345.95	9.7936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002665	2269647	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 5252; End: 6208 Strand: +

Full Sequence      

MNMIKNSFYNLRLSCSGQEFSWKNKLKNRLLGWAVGSALLGLWTLAPVYADEIRAEVRTI
NGQKEIVYTNATNDSFMHGSSYPTYQGKKRSSSKKTASTASKKKTSVARTSGSSSATKVA
PQGKRRPDGTYEFAPPQYQVYEVKPRYAYRDNWSFATFDSSKRQPRLVSYYGWDPNDPQQ
KQRAWVEVDLNPIILKYAKIWGVDPLLVEIVICHESGFNPNAVSPVGAVGLMQLMPATAS
GLGVYDAFDVEQNIAGGTRYIASQLERFNSVPLALAAYNAGPGAVMQYGGVPPYSETQYY
VDTIYGEYLAGKRAREGR

Enzyme Prediction     

No EC number prediction in MGYG000002665_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	205	310	7.7e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	9.08e-43	205	308	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.50e-39	192	301	8	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	8.43e-36	193	302	7	138	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	2.11e-33	194	287	1	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	7.21e-33	194	290	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS92357.1	8.46e-39	179	310	39	168
BAB06571.1	1.03e-37	163	309	73	230
AEE96658.1	1.43e-37	189	304	88	203
QHS22538.1	1.97e-37	189	310	84	206
ARK31455.1	3.76e-37	188	309	93	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	2.07e-11	142	304	360	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	2.07e-11	142	304	356	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	2.08e-11	142	304	366	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.09e-11	142	304	370	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.10e-11	142	304	376	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.31e-34	187	310	57	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.52e-32	198	308	1430	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.52e-32	198	308	1430	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	2.66e-15	201	281	18	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	2.73e-13	191	314	287	434	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.239720	0.722734	0.035935	0.000760	0.000390	0.000449

TMHMM  Annotations     

start	end
30	49