CAZyme Information: MGYG000002907_00537

Basic Information

• Species: Anaerosporomusa sp900542835
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Sporomusales; Acetonemaceae; Anaerosporomusa; Anaerosporomusa sp900542835
• CAZyme ID: MGYG000002907_00537
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179	MGYG000002907_4|CGC1	20588.58	7.3964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002907	3559920	MAG	United States	North America

• Gene Location: Start: 32424; End: 32963 Strand: +

Full Sequence      

MAVSLLVVSAASQIYSSDWFQKKFAYPFLYQELIFTHAAKNQLDPWLIAAVIKAESRFRL
TARSPVGAVGLMQLMPETAKWIAGQQNHPDFQLKDLENPDANIRFGSWYLASLAQEFNQN
EVLMLAAYNAGRGNVKKWMEQYGWAMDFSEIGQIPFPETREFIADVLHNKKRYQELHAR

Enzyme Prediction     

No EC number prediction in MGYG000002907_00537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	40	174	3.3e-30	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.47e-77	27	172	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.51e-60	25	176	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.09e-41	45	169	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.41e-31	38	145	5	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.84e-29	37	144	4	111	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF51128.1	2.85e-78	5	179	15	189
QDR80996.1	3.14e-75	5	179	15	189
QJW46656.1	1.21e-72	1	179	12	189
QJW46652.1	1.21e-72	1	179	12	189
AJQ28099.1	3.26e-70	14	179	24	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.13e-24	30	176	420	562	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.13e-24	30	176	416	558	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.14e-24	30	176	426	568	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.15e-24	30	176	430	572	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.16e-24	30	176	436	578	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.30e-19	8	167	458	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	3.27e-19	8	167	458	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.27e-19	8	167	458	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	5.15e-19	30	169	1422	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	5.15e-19	30	169	1422	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.671583	0.327115	0.000422	0.000312	0.000209	0.000365

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002907_00537.