CAZyme Information: MGYG000002930_00141

Basic Information

• Species: Prevotellamassilia sp900540885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900540885
• CAZyme ID: MGYG000002930_00141
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		46889.04	9.5075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002930	2680968	MAG	Mongolia	Asia

• Gene Location: Start: 28775; End: 30043 Strand: +

Full Sequence      

MLRLSFLLLCCVVFSFTSCRKRNVTSQSDNGAFAKAKTNATGPVVDRIMQSGELIIGTIS
GPDTYFDYQGRGMGLQYALAEDFATTLGVGVRVELATDSLQLVKMLKQGEVDLIAYPLSS
SFCKKEHITAAGAINEKSKNSWATLSTVSDLIEALNDWFGDGVELKAKKQEADWLHNRRV
VRRKVRAPFISREKGIISTYDSYFKDAARAVGWDWRLFAAQCYQESGFDPNAVSWAGACG
LMQLMPATAAQYGLSRNQIFGPSENIAVAARHIQHLQQQFASIREPQERVKFVLAAYNGG
LGHIRDAQSLARKHGGNANLWSDVGYYVRNLSQPQFYRDPVVKHGYMIGSETYGYVQSIF
DRWRQYGGNVHSLGASSVELSSSSANKVRSGSDGERITPHKKNRYSRSHIILSPEELQKQ
AQ

Enzyme Prediction     

No EC number prediction in MGYG000002930_00141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	210	362	1.4e-27	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	5.33e-75	204	366	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.96e-49	1	366	10	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	8.99e-38	46	370	17	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	2.18e-23	204	313	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	4.15e-23	200	305	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	9.35e-107	48	374	80	402
BCS86517.1	3.19e-102	48	374	41	363
EFC70077.2	2.72e-101	6	378	7	375
QUB48180.1	1.09e-100	48	375	50	378
QNT65891.1	3.56e-100	26	368	44	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.99e-23	200	359	259	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	2.11e-23	200	359	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	2.11e-23	200	359	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	5.97e-23	200	359	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	5.97e-23	200	359	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q30PQ0	2.52e-30	189	361	282	450	Membrane-bound lytic murein transglycosylase F OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=mltF PE=3 SV=2
A0KJ50	5.67e-29	45	366	40	449	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4SNZ5	7.74e-29	45	366	40	449	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
B1JDH3	9.73e-25	96	359	180	444	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain W619) OX=390235 GN=mltF PE=3 SV=1
B0KRE9	1.79e-24	38	359	141	444	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000007	0.003977	0.996047	0.000001	0.000002	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002930_00141.