CAZyme Information: MGYG000003018_00152

Basic Information

• Species: Alistipes_A sp900549685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900549685
• CAZyme ID: MGYG000003018_00152
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000003018_4|CGC1	51513.75	7.3053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003018	2600623	MAG	China	Asia

• Gene Location: Start: 34585; End: 35967 Strand: +

Full Sequence      

MTGIRNLSVRFFSLLCLLFATSCSRDVVRMPSVRERGHLTVVMENLLPGYFVFGGESYGY
PYDLFKAYAEHLGVELRVVVGGSSLECARMLSDGGADLAATLADRSPLPDGFSSIPVYRT
SYVLLADKKTAAQARKTEHFRLTEFLQGKKVLIAPGFKRSGAYDMLLDSLASPTEIYLST
ENSFESIAAVGERRYDFLICEMSEAQLGCAFQKNVGQVYRFAEPVSMNVLASPLDEGLRD
DFETWLARFRCSEEYAMLNYLYFEKGIVGQMTGRRWTATETGGISVYDDLFKKICEKEGY
DWRLVSAIAYSESRFNPWLVSHRGAQGLMQIMPHVARQFGVSGNVMDPKNNVLLAVKVLS
KIEKSLDFASGTSADDRMKIVLACYNGGIGHVTDARNLARKYGADPDSWADVSRYLTLKS
DPAYADDEAVRHGRFVGQQTLAFVDNVYNRYVRYCTNVRR

Enzyme Prediction     

No EC number prediction in MGYG000003018_00152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	300	453	1.3e-21	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.13e-69	291	456	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	5.89e-39	29	451	15	427	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	5.21e-37	1	451	1	446	membrane-bound lytic murein transglycosylase MltF.
cd16896	LT_Slt70-like	2.27e-20	287	392	4	109	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.15e-20	287	409	6	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24715.1	1.06e-197	43	460	1	417
BCG53195.1	8.17e-175	33	460	1	424
BBL15387.1	7.75e-65	284	455	49	222
BBL03277.1	1.09e-64	284	455	49	222
BBL07161.1	5.91e-63	284	460	56	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA2_D	7.42e-30	17	451	32	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	2.54e-29	17	451	32	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	2.54e-29	17	451	32	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA3_A	1.18e-28	17	451	32	459	Crystalstructure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_B Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_C Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_D Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_E Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_F Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_G Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_H Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_I Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_J Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_K Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_L Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	1.18e-28	17	451	32	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	2.20e-36	8	451	14	447	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
Q30PQ0	2.05e-35	30	449	36	450	Membrane-bound lytic murein transglycosylase F OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=mltF PE=3 SV=2
A8ZWR8	8.93e-32	25	451	29	445	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q3KHL5	9.71e-32	18	451	22	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1
A4VP14	3.00e-30	18	451	22	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000075	0.999984	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003018_00152.