CAZyme Information: MGYG000003387_00589

Basic Information

• Species: Pseudomonas_R sp900766265
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_R; Pseudomonas_R sp900766265
• CAZyme ID: MGYG000003387_00589
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	MGYG000003387_5|CGC2	73852.98	9.7687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003387	4465621	MAG	United States	North America

• Gene Location: Start: 177589; End: 179514 Strand: +

Full Sequence      

MRGRLSCFIVCLFFSAASLSSHAATLSQQRQYYDEAKNALAKGDRGPYTRYASLLRDYPL
TPYLAYDDLTARLKTASNAEVDRFLTDHGDLPQAGWMKLRWLRLLAQRGDWQPFIKYYDP
KLNFTELDCLYGQYQLSHGQRTEGFATAERLWLVGKSQPDACDSLFDRWAAEGQLTEERI
WKRARLAVEAGNYSLATFLSKRLTTLQSEAKLMIEVAQKPQMLSQTNRFAPASEAMGDVV
GIGLRRLARQGPEKALGMLESYAARMKFSTDEKVAIARQIGLTFARRFDERALQVMATYD
PDLRDNTVSEWRARLLLRLGRWDEAHALIQRFPQELAETSRWRYWKARSFELARPNDLQI
PQLYQPVSRERDFYGFLAADRIQAPYKLNHQPLALSKAVMEKVRNTPGIRRALEFHARGQ
IVDGRREWYHVSRHFNRDEMVAQARLAYDMEWYFPAIRTISQAQYWDDLDVRFPMAHRGT
LVREAKKRDLHPSWVFAITRQESAFMADARSGAGATGLMQLMPATAKETARRFNIPLASP
QQVLNPDTNIQLGAAYLSQVYAQFNGNRVLASAAYNAGPGRVRQWLRGAEHLSFDVWAES
IPFDETRQYVHNVLSYAVIYGQKLNAPQPLVEWHERYFDAR

Enzyme Prediction     

No EC number prediction in MGYG000003387_00589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	484	618	3.4e-31	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	3.91e-114	25	637	29	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.31e-75	472	620	1	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	7.35e-48	474	616	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	8.51e-40	340	631	1	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.02e-37	492	617	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGZ31667.1	0.0	1	641	1	642
AHL75906.1	0.0	1	641	1	642
QUE74283.1	0.0	1	641	1	642
AFN77740.1	0.0	1	641	1	642
SEH79977.1	0.0	1	639	1	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FCQ_A	0.0	29	639	1	611	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	0.0	1	639	1	640	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	0.0	29	638	1	610	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	0.0	28	639	1	612	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	1.11e-98	25	637	2	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.08e-99	21	637	25	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.23e-98	10	637	16	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.23e-98	10	637	16	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	3.35e-39	244	631	204	583	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	2.30e-16	479	615	62	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000538	0.998299	0.000494	0.000209	0.000208	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003387_00589.