CAZyme Information: MGYG000003665_00817

Basic Information

• Species: HGM10836 sp900772095
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; HGM10836; HGM10836 sp900772095
• CAZyme ID: MGYG000003665_00817
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000003665_29|CGC1	36494.23	6.8994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003665	1605651	MAG	Peru	South America

• Gene Location: Start: 6315; End: 7322 Strand: -

Full Sequence      

MRLKHIAIIGSLFPILISIVLFFGVLISAEDDDGGGNYSSSFGGMNLSAEVLKHQPMVEK
YAREYGISEYVNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFSSLL
SSCKSQGIDDLNVAIQSYNYGGGYVGYVAGKGKKHTYNLAENFAKEKSGGKKVTYTNPIA
VAKNGGWRYGYGNMFYVELVNQYLTVPQISGELAQKVMNEALKYQGWKYVYGGSNPNTSF
DCSGLTQWCFGKAGISLPRTAQMQYDATQHIPLSQAKAGDLVFFHSTYDAGSYVTHVGIV
ISPTQMYHAGDPIGYADLTNSYWQQHLIGAGRVKQ

Enzyme Prediction     

No EC number prediction in MGYG000003665_00817.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.59e-60	48	204	1	165	Lysozyme-like.
cd16891	CwlT-like	1.89e-53	54	204	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	2.72e-33	226	332	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	1.04e-31	214	333	366	481	invasion associated endopeptidase.
COG0791	Spr	6.39e-25	214	330	75	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC48891.1	2.43e-239	1	335	1	335
BCL58648.1	4.31e-233	1	335	1	335
BBK21844.1	1.13e-228	1	335	1	335
AXB66501.1	6.56e-228	1	335	1	335
QQV07015.1	1.09e-226	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.07e-198	29	335	2	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	9.37e-138	43	333	18	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	4.50e-15	214	333	14	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
2EVR_A	3.58e-12	202	333	89	237	ChainA, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_A Chain A, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_B Chain B, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102]
6BIQ_A	1.26e-11	210	322	154	265	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	3.35e-72	45	334	51	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	7.03e-24	217	333	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	4.01e-23	220	333	415	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01836	1.39e-22	220	333	358	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
O34636	9.01e-22	54	214	55	214	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.738321	0.254228	0.004732	0.000384	0.000282	0.002075

TMHMM  Annotations     

start	end
7	29