CAZyme Information: MGYG000003735_00853

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; QFNR01
• CAZyme ID: MGYG000003735_00853
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000003735_90|CGC1	70950.47	9.3022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003735	2323542	MAG	Canada	North America

• Gene Location: Start: 5746; End: 7737 Strand: +

Full Sequence      

MTSLSKTGRIGPIGLACGRLSAAGMALALCAAGAALSGCANGGEADGQKSAHVSQGSLAE
RRAAAPFSVPNRPADDPLSTLADYDAFNGALAAAKSGDDLAAQAFVQSGDNAMTEDVAKA
WAISMAKRREFTLFSSALAKISSEAANADKELLCAMEYGRVFSTKGHSPQARTLAESNEP
LPALCNDLIAWGVGAGQVPAHLAFKRVLVNLSAGQRREAETLARALGFSLDDPNGDAALP
PSVAQFAQAAREIAPIVTPKGRNSPAAEEFIARGDVSTIPIRGLPNPYAFAYGALGLSKA
KDLNPAAALRLYGFADPYAMSDEQFEWRARSALRLQNWNALSRAIDGMPPRLRSKPAWLY
WKAECLRRLGFGAQASALYAQAADSGRNYYALLAADAIGRSLPFADAAPKPAARESNAVL
ADGAVMRALTLFRASIERSDRAMRTAAQRQWRYAMRPYGDAALIAASAVAERAGFHEMSI
YSADKADGLLVFSLRYPAPFRDLVEKWSRAHGVRPDWVYGVIRQESRFMYNARSRAGAQG
LMQVMPGTAKLIARKIGLSGYDPNDMDVNVRMGTWYLGDVEAKLGHEALATAGYNAGPNR
ARRWQADVPMDATIYAETIPFDETREYVKNVMANAAYYAAVFSGTPPTLRSRMGVAPARG
DEF

Enzyme Prediction     

No EC number prediction in MGYG000003735_00853.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	513	637	1.8e-27	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.61e-65	495	640	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.29e-45	497	634	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	4.08e-35	170	649	151	634	lytic murein transglycosylase; Provisional
COG0741	MltE	2.26e-32	368	650	6	295	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.73e-29	515	636	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASP16959.1	3.13e-141	19	659	6	608
QMT39439.1	2.65e-135	71	659	43	616
AJC63097.1	1.41e-133	68	659	40	611
ARC06986.1	1.64e-133	68	659	45	616
ADY96453.1	1.64e-133	68	659	45	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O29_A	8.28e-136	47	659	1	596	Lytictransglycosylase in action [Neisseria meningitidis]
5O1J_A	1.01e-135	68	659	9	580	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.78e-135	68	659	5	576	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	2.42e-135	68	659	15	586	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.73e-135	68	659	19	590	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	4.93e-29	295	651	273	637	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.93e-29	295	651	273	637	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	6.48e-27	319	638	309	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	1.73e-14	447	652	375	586	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	2.79e-13	504	639	64	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002229	0.060047	0.937677	0.000037	0.000038	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003735_00853.