CAZyme Information: MGYG000003761_00384

Basic Information

• Species: Stenotrophomonas maltophilia_S
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_S
• CAZyme ID: MGYG000003761_00384
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000003761_5|CGC1	25126.46	10.1499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003761	4722963	MAG	Canada	North America

• Gene Location: Start: 36342; End: 37028 Strand: -

Full Sequence      

MTRRGRPDPGVRLAIAFSLVLLALFISAFCDKAEAAPTQASVKVAPASALYRHRVEQAAS
RAWGVNASSARLAAQLHQESAFRADARSPVGAQGIAQFMPSTARWIATIYPADLAGFDPW
NPQQAILAAALYDRWLFDRVAEYSQGRMSNCSRWAFTFRAYNGGEKALNRERALAYTSGV
DANDWRAVERFRARADWAHRENTGYPKRILLTLEPAYLAAGWTGAATC

Enzyme Prediction     

No EC number prediction in MGYG000003761_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	72	208	7.7e-18	0.7185185185185186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	6.18e-19	72	185	15	116	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	2.82e-17	72	170	4	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	8.02e-17	72	167	8	97	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.50e-14	57	179	2	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	3.36e-13	78	185	30	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGM00788.1	2.09e-148	1	228	1	228
QDY50212.1	5.99e-148	1	228	1	228
QWN20087.1	1.48e-102	8	228	17	239
ATS42772.1	1.48e-102	8	228	17	239
ATS46428.1	1.48e-102	8	228	17	239

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003691	0.304659	0.690530	0.000612	0.000313	0.000186

TMHMM  Annotations     

start	end
13	30