CAZyme Information: MGYG000004118_00444

Basic Information

• Lineage: Bacteria; Firmicutes_B; Dehalobacteriia; UBA4068; UBA4068; HGM13862
• CAZyme ID: MGYG000004118_00444
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		22267.22	4.117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004118	1412421	MAG	United Kingdom	Europe

• Gene Location: Start: 1933; End: 2532 Strand: +

Full Sequence      

MTRRKGCGCFSLIIIILIIALLVGIGIKNKDKILAFFYPTEYESIISEYCDQYGVDKWLV
FALIKAESGFDADAVSAAGAYGLMQLMPDTAQWLIDRGEFAMEATAALENPRENLQLGIY
YLSVLFENYQDEQGYTDPAIVIAAYNAGMGSVSEWLNDGTWDGSLSNVSDIPYPETERHV
KSVLRNYQTYTRLYAESSD

Enzyme Prediction     

No EC number prediction in MGYG000004118_00444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	59	192	1.6e-25	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.61e-61	39	188	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.27e-48	38	193	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.75e-35	59	188	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.99e-31	38	197	135	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.22e-25	44	188	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR36443.1	1.02e-41	38	194	36	187
ADI02449.1	3.45e-41	34	195	34	190
ALS20892.1	3.94e-39	38	196	33	186
ASR48263.1	1.41e-38	34	196	28	186
ATW28310.1	1.99e-38	33	194	31	186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.03e-16	38	196	445	594	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.07e-16	38	196	474	623	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	7.59e-16	38	196	445	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	7.59e-16	38	196	446	595	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	8.58e-15	38	194	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.47e-18	43	187	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
A5UDW4	1.72e-14	41	187	188	342	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mltC PE=3 SV=1
Q4QMD8	2.36e-14	41	187	188	342	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=mltC PE=3 SV=1
P44049	2.36e-14	41	187	188	342	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltC PE=3 SV=1
A5UHR5	2.36e-14	41	187	188	342	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.844375	0.097189	0.047084	0.000398	0.000358	0.010623

TMHMM  Annotations     

start	end
7	27