CAZyme Information: MGYG000004150_00327

Basic Information

• Species: Comamonas kerstersii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Comamonas; Comamonas kerstersii
• CAZyme ID: MGYG000004150_00327
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		32089.35	6.5061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004150	3434704	MAG	United Kingdom	Europe

• Gene Location: Start: 331356; End: 332249 Strand: -

Full Sequence      

MSKSGNWAASVRTIASDIAEGFLEITHNSFALIGLVVAFAAIALFAQPELRQQGEAQLRT
WLQERHVAVAGVTPEPSAIERATAVNPKELPKDQAAVAYWISKKYRVAPEPIGALVEEAY
QIGEQYKIDPTLLLAVMAIESRFNPFAQSSVGAQGLMQVMTRVHTEKYDNFGGNHAAFDP
ISNLRVGASILREYMQITGSVEGALKYYVGAANHGNDGGYVAKVLAEHSRMRQVAGRSTP
ETTVRPGLVAKRQITPIKMEEGEAAAEQKAAETERPASVAVNRTQDEASQVVASSNL

Enzyme Prediction     

No EC number prediction in MGYG000004150_00327.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	128	231	4.5e-19	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.97e-18	130	226	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.31e-18	121	221	3	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16893	LT_MltC_MltE	1.78e-14	124	192	8	86	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
cd16896	LT_Slt70-like	3.92e-14	117	208	6	102	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.56e-13	121	208	145	237	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQZ98728.1	2.07e-205	1	297	1	297
QTW20327.1	9.83e-204	1	297	1	297
QXW17340.1	4.71e-148	1	258	1	258
ANY62008.1	6.45e-141	1	266	1	266
QTX21643.1	6.45e-141	1	266	1	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	2.30e-06	121	191	180	256	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	5.49e-06	121	191	180	256	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	9.03e-10	125	248	17	136	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	1.68e-07	123	230	1430	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.68e-07	123	230	1430	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
Q7N7I2	3.08e-06	121	257	197	348	Membrane-bound lytic murein transglycosylase C OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mltC PE=3 SV=1
A8API2	4.14e-06	121	191	199	275	Membrane-bound lytic murein transglycosylase C OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000042	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43