CAZyme Information: MGYG000004416_00276

Basic Information

• Species: UMGS1477 sp900552205
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1477; UMGS1477 sp900552205
• CAZyme ID: MGYG000004416_00276
• CAZy Family: GH23
• CAZyme Description: Outer membrane protein assembly factor BamD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	MGYG000004416_9|CGC1	77801.82	9.4565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004416	1852047	MAG	Israel	Asia

• Gene Location: Start: 6900; End: 8879 Strand: -

Full Sequence      

MKKLNLFLLAIICIVVLYITIHFKDFDFTNKAYKIYKQGIYFEQNVDYQNSYYNFSKIPK
YSPLYKFAIIHQAQNAYKLSDYKTAINYYLKYVNMFPDTILTPKAYYYLGLSYYKDKEYK
SAYHTFNNLSKKYPKTNFGIAANYYLGLINENIHLKSKEETLNYFIKYLSLAPDGTLSKN
VLKEVKKLDVVLSNENKKIIGIAAYKNNMYSDCIFYLNQLKDPNDWSYLANSYMKTNHFG
VAQGIFEKGLKSSNANLDKDELYEGIENYVSLFQNKKNGWLKARSIIEQNSSKSGLDFVL
YNLAKYENEKNAINYYQTIYKNFENGDFASESLWEIFWYYYKNKSYKTAKMYALKHVDLY
NNTQASPRILFWLGKICQHERNYSAANSYFKDVITKYPNSYYAFRANSKLNNKNDVKLKR
NYKPLSEKIINPQFPINYTKLSPKDMSLVMKIIDLDDYSLLEQVDFDTKFIDSWINYKKG
NYVRSVNLAKTAFDELDVKPLFYDEVYKLVYPLHYAPKINAYSSIWNLDPYLVISLIKEE
SYFNTNAKSIYGAVGLMQLMPSTANFIAKNYKLYYNSLYNPEDNLKLGTAYLSYVIKDCD
NILYAIAGYNGGHNNMKTWQKYTNNNDFDEVIENIPYPESKHYVRKVFSSYWNYKNIYK

Enzyme Prediction     

No EC number prediction in MGYG000004416_00276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	529	653	5.5e-25	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.59e-51	511	657	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	9.31e-44	512	651	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	7.98e-30	530	652	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.64e-26	519	630	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16893	LT_MltC_MltE	1.99e-25	517	647	1	157	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	2.86e-82	30	658	34	657
AFY88415.1	2.90e-43	219	658	227	705
BAQ63384.1	1.85e-41	148	658	157	711
AFZ32568.1	1.19e-40	201	658	209	703
BAQ62516.1	2.07e-40	223	659	234	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	4.32e-15	465	654	395	600	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	5.71e-15	465	654	395	600	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5MPQ_A	9.20e-15	364	650	269	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.27e-15	364	650	273	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.39e-15	364	650	279	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.47e-14	465	654	422	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.47e-14	465	654	422	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	3.66e-13	460	647	382	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O64046	4.98e-13	515	651	1422	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.98e-13	515	651	1422	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.853302	0.143597	0.001488	0.000407	0.000387	0.000813

TMHMM  Annotations     

start	end
5	22