CAZyme Information: MGYG000004484_00176

Basic Information

• Species: UBA2903 sp002349565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA2903; UBA2903 sp002349565
• CAZyme ID: MGYG000004484_00176
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653		73949.67	10.1015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004484	1902889	MAG	Israel	Asia

• Gene Location: Start: 176102; End: 178063 Strand: +

Full Sequence      

MLRFANIFVCLTVCLFSADAAAHAPAKPQSSASVKAAVDAAMRDEWQQAARLAKKTADAK
VVKLVEWLRLTRGKDDIAFADMERFMKNNADFPRIYVIRRNAETALLKQGDNAALEKWFK
KHPPVSPAAVMKQAELLLAKKEWERALPMLYNLWAKGELSDDETTEAAEKLSLLLDTHDY
AARVETLLNERKPKQAKKLLPSVDDEERKLANVRIGLMTNADHASRKIKDLPTEQRQNAG
LLFDELRWLRIRGKYADAAKMLEKVPFSKQTGARWWNERVTVARQLLNEGHAHQAYNLVK
HHSLEQGGDFADAEWLAGWIALRNLKQNKRAREHFSKMLSSVKSPVSLARGEYWMGRAFE
DAKNKSEAVKWYRKAANRITTIYGQLAALRLPKDVLPSLPAENAPTLSDMEEIRKSELFQ
IAKLLQQAGQSELADVFAARLIANASTPERTTALAYALAEDLQRPDLAVNIARRARSNGT
YILSLGYPVWDLKHDERAEQAIVLSIIRQESNFSTEAVSPAGARGLMQILPSTAKQIARR
KKKSFSPQKLNSNPDFNVEMGSTYFADMLKRFDGSYILAVAAYNAGPTNVRKWMKTLGKP
DEQIDAVDWIERIPFNETRNYVQRVLENLHIYRRNLNYPDAALNTWQQAATQN

Enzyme Prediction     

No EC number prediction in MGYG000004484_00176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	498	631	2.7e-30	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	2.40e-70	486	634	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.23e-48	503	628	22	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.60e-37	501	629	2	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	7.68e-34	353	639	5	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	7.26e-30	500	648	494	642	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWK87147.1	1.48e-130	11	644	45	676
CCQ73475.1	4.57e-127	22	647	31	660
ASG21876.1	4.48e-126	26	633	34	652
QCO13905.1	5.97e-126	18	644	26	651
ACI98911.1	6.89e-126	22	643	25	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.70e-28	81	648	52	607	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.99e-28	81	648	81	636	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	4.11e-28	81	648	52	607	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	4.13e-28	81	648	53	608	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5O1J_A	3.45e-27	290	632	215	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	4.79e-20	336	648	309	643	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	1.47e-19	353	633	350	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.47e-19	353	633	350	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	1.16e-17	354	626	286	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	5.05e-17	499	625	74	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.999012	0.000171	0.000189	0.000168	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004484_00176.