CAZyme Information: MGYG000004626_00115

Basic Information

• Species: CAG-521 sp900553105
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp900553105
• CAZyme ID: MGYG000004626_00115
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		79772.93	9.3335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004626	1754327	MAG	Germany	Europe

• Gene Location: Start: 120382; End: 122463 Strand: -

Full Sequence      

MFLSLKRFSFLRLILCASFLSAVLFCTPANAATAIAQQSYATMIEELAANDRFLFIKELY
ENKKLAEVDHPEKYLPDEDEPLREYVQAWHLIDRARTQNFDEKLENEILQFITEHDGLYI
AERLRTDWLLLKAQDWNDKRQWGYFRQLRQELVWNKNEPAVVCWDIYHQLQLTRRGALRA
DKTESFFNVLKSPPYRDIGICRKASDELLDKAPTLAFPRLVVLIQHNQISLARNIVNDLI
AQKRLPTSARQALNQPSRWYRQHRNRLAKQNKFVLQIAAYRLAGSNFDAAVRIAETLKGR
LNKQERSALWARLGHLAALNHDAKALDYYARGGNTVCSSRLTANSNDCLEWRARSALRLQ
RWDSLLSFIHAMPATLANKEAWTYWQGVAYAQKGRSENAKRCWGRLTNVRTFYGKLAAEA
LGKPIVYPLDIENSLDDGVVDEFGKQPTVIRARAFYKHGLIAEGNREWQWAIRNSSDQQL
LAATLWAEENRYLHRSINTAIRLALQMPVEHQLLYPRPFEDEIVKYSEEAQIDPDWVYGL
IRQESRFIAAARSSVGANGLMQIMPATAKWIAKELAIDNFKPNSIYEIDTNVRFGTFYLR
TLLDRLDNNIVLSTAGYNAGPNRAHRWRSTLTQPVEGAIFIETIPFNETRLYVQNVLANT
IEYAQAQSKTVNSFKALLGTVTPESATEVNDKI

Enzyme Prediction     

No EC number prediction in MGYG000004626_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	529	668	5.9e-25	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	9.86e-70	514	664	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.50e-52	516	659	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	1.51e-44	344	658	310	619	lytic murein transglycosylase; Provisional
cd00254	LT-like	8.24e-35	534	659	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.55e-34	382	664	3	284	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS89613.1	3.74e-108	68	683	177	794
BBF22242.1	8.32e-108	81	683	190	785
AJP56054.1	1.60e-106	28	684	33	668
QDA54820.1	1.18e-105	53	683	153	781
ANC44955.1	9.98e-104	41	684	46	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.14e-74	102	664	33	556	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.35e-74	102	664	37	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.69e-74	102	664	43	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.95e-74	102	664	47	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.37e-74	102	664	53	576	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	6.90e-39	341	663	307	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	6.90e-39	341	663	307	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.26e-38	341	663	307	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	9.45e-23	357	669	273	578	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31976	2.71e-14	515	692	1418	1567	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002793	0.806188	0.189342	0.001127	0.000278	0.000238

TMHMM  Annotations     

start	end
13	35