CAZyme Information: MGYG000004639_00086

Basic Information

• Species: CAG-495 sp000432275
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp000432275
• CAZyme ID: MGYG000004639_00086
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		28934.45	10.4857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004639	1878053	MAG	Germany	Europe

• Gene Location: Start: 102804; End: 103553 Strand: +

Full Sequence      

MRSFVSKNLMFLLILLMLIQPVQAQAYSEVRDDALVCMDATQKFEKKYQIKEHLLTTISS
VETGRWNAKTKQKVAWPWTVNAQGKGTYFETKAQAVREVKRLQKAGVKSIDVGCMQINLA
YHPDAFKSVEEAFDPEKNVEYGAKFLKNLYANRDNDWIKAAMAYHSSVPRKAQRYKKKLV
SAYEMVKQAQNNLNTKLFGKVEQPKTKKLETESVYAKNKRRIEQTVAQKANAWRQAKLEE
YRKNKQRQN

Enzyme Prediction     

No EC number prediction in MGYG000004639_00086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	190	6.2e-18	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	1.01e-13	48	184	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.28e-08	108	179	32	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16892	LT_VirB1-like	1.81e-08	80	151	31	101	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	6.21e-07	112	184	25	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.01e-06	32	174	102	247	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10590.1	1.77e-61	17	191	1	175
AMW35440.1	1.09e-46	36	200	44	206
CDK98691.1	2.62e-46	37	184	23	169
CAX83981.1	3.55e-46	23	190	19	185
AVM77174.1	5.21e-46	37	184	23	169

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999194	0.000167	0.000149	0.000135	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004639_00086.