CAZyme Information: MGYG000001353_00111

Basic Information

• Species: Collinsella aerofaciens
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens
• CAZyme ID: MGYG000001353_00111
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
952		102618.08	4.7031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001353	2439869	Isolate	not provided	not provided

• Gene Location: Start: 6276; End: 9134 Strand: +

Full Sequence      

MKRLKASAALVCTLLMGWSQIIQPYSAYALSVQAAAASQSVSQTSNEYESQGASSQGAQD
DASGSQGVTEWYGDDANAARPDGGVDSDSGEQPGIGIEESRVDESNGEAPTDDSTEMNSC
EADSLEPNSWRFENGVLIDSDNGDIDAQSLTDDPLPNGAVARGIDVSNHQGTVDWNKVKA
AGIDFAILKVGPVYGKPDDSFERNAAECERLGIPYGVYYYSYARSVEDANKEADRTLAWL
GGHHPSLPVYYDLEDSYILQDPDFSKDKLTQIAQAFCNRMEAVGFKSGIYANLNWLNNYL
NSPSLSGYDHWVAQYNWRCDYAGSYSFWQYSSSGNVPGVNGRCDMNYCFNGSLLNVDDSK
MHIQYEAHVSNIGWMSSKRDGSTAGTTGQSKSVEDLKVSILNPVEDGSVQINANVSGVGW
QGWDTPSASEGGTTGQGRAVEAVRLRLTGSLAKDYDVYYRVHASNIGWMAWAKDGEEAGT
TGFGRSVEAVQIRLVKKGDAAPSSDGANVDYAFKKKPMSLTYRAHVSNVGWQGAVSDGAT
AGTTGRGLALEDLKLSLDSSDYSDGSCVQIDAHVSGVGWQGWDTPSASEGGTTGQGRAVE
AVRLRLTGSLAKDYDVYYRVHASNIGWMAWAKDGEEAGTTGMSCSLEAVQIKLIKKGTSH
PDTSGYPHLEIPTVTYSAQVKGAWQNYVPAGEVSGTTGQGIPITGFSAKTTSSVAGGIAY
QLHLSNVGWTSGKTNGEQLSSTAESNSVEAIKISLSGDLATYFDVWYRVHVDNVGWLGWT
KNGAVAGSTGYGTHVQAVQVRLTRKGANAPGSTVSPCLLGQPSAFANPMQKKIVDLARQV
PSPGPGLCSEWIADIYERAGFRNVHTDACDYYWDYCKFTDYSQLKVGMVIAVPSHTHTRM
GSIYGHVCLYIGNNQVMDNVGQIRTLDMAYWLDYYSTSYKPKWGWYDNVPLA

Enzyme Prediction     

No EC number prediction in MGYG000001353_00111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	164	339	2.1e-45	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.15e-74	162	349	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.63e-34	162	347	1	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG5492	YjdB	2.56e-24	354	654	13	307	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
cd06524	GH25_YegX-like	7.73e-24	162	351	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06525	GH25_Lyc-like	2.91e-23	162	347	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33416.1	0.0	136	952	1	976
AWY97591.1	5.04e-75	158	699	92	619
AZH69442.1	1.00e-69	122	364	32	274
ATP53732.1	2.56e-68	122	349	32	265
BAN76667.1	2.68e-57	128	364	43	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	2.47e-21	164	345	272	464	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	5.85e-21	164	345	272	464	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	2.49e-12	162	356	6	209	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRT_A	2.32e-10	162	395	21	261	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRU_A	3.75e-10	162	346	21	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	4.17e-11	162	356	83	286	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P34020	1.37e-09	162	354	2	186	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P26836	2.06e-08	162	359	10	206	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000791	0.998074	0.000507	0.000212	0.000191	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001353_00111.