CAZyme Information: MGYG000002324_00321

Basic Information

• Species: Ligilactobacillus salivarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus salivarius
• CAZyme ID: MGYG000002324_00321
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		68984.9	4.5244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002324	1978364	Isolate	China	Asia

• Gene Location: Start: 324029; End: 325879 Strand: +

Full Sequence      

MFQGKILVQGVNRAEKEPLNLFDPKSLQIQWEVNQTWSLQLTAYNDGSLAYQMLESEASI
FLDNQEYIIKQVADDSSSGLDSVQVTATHVYFEVQKIRKYKDYIDPIDKDKQTDVKVLKT
DSTKSDDSDNTKTDTNEKTEGNTTTKITTKTTDETQQDNQNQVTYSIQDVLDHWLKDNNL
GFTYEVIGSFEKKELEELKDGTGADMLSKISDTWNNAIIYPDNRKIMVYSADKFNLNRGN
RIDYLNNASEIKFSTDSTSLTNMVYCIGGKYSVETTTETTTTTTTTTTSGGWGWPFPDVG
EGNFMQVQRFGNDGGFRQNGFHDGLDFGSVDHPGRDVHAIHGGKVTIKSYMGGLGNYVVI
SGSGYNVVYQEAFSSASNIIVNVGDTVKVGDVIGYRDTDHLHVGVTKADFNVAVGKSFTN
DGTWLDPLELIKNGPSDTDTETSSETNSNSNTQEYYYFAPFMYRDEESIKKYGEHPAEPI
EDGRFKDKSAMIEYVKTKLQPEPSLSIDVTTTTDIKPIAGDVVHVTVKSQNISTNFTLTG
FTWYPYSYPVDNPTSITLNSNVQNILDYQNSRQRQFSKAISKLKSSTNEVVNNINSFNEY
GGNQQLRTWLNDFVGG

Enzyme Prediction     

No EC number prediction in MGYG000002324_00321.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18994	Prophage_tailD1	3.37e-21	6	89	1	84	Prophage endopeptidase tail N-terminal domain. This domain represents the N-terminal domain of prophage tail proteins that are probably acting as endopeptidases. This domain has a RIFT related fold.
pfam01551	Peptidase_M23	1.65e-15	320	407	1	89	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
cd12797	M23_peptidase	3.94e-15	322	405	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.
pfam06605	Prophage_tail	1.26e-14	157	268	10	121	Prophage endopeptidase tail. This family is of prophage tail proteins that are probably acting as endopeptidases.
pfam06605	Prophage_tail	1.18e-11	445	569	126	248	Prophage endopeptidase tail. This family is of prophage tail proteins that are probably acting as endopeptidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP34768.1	1.03e-153	26	591	26	535
QLL72780.1	2.11e-153	26	591	26	535
ABD99110.1	2.81e-153	26	597	26	540
QXL49889.1	4.08e-153	26	591	26	535
ADJ78579.1	1.12e-149	26	591	26	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GT1_A	2.37e-49	296	434	29	170	ChainA, Choline binding protein A [Ligilactobacillus salivarius str. Ren]
3GS9_A	1.54e-08	6	268	6	214	Crystalstructure of prophage tail protein gp18 (NP_465809.1) from Listeria monocytogenes EGD-e at 1.70 A resolution [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002324_00321.